KEGG   Escherichia coli K-12 W3110: JW4277
Entry
JW4277            CDS       T00068                                 

Symbol
fimA
Name
(GenBank) major type 1 subunit fimbrin
  KO
K07345  major type 1 subunit fimbrin (pilin)
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecj02044]
    JW4277 (fimA)
   02035 Bacterial motility proteins [BR:ecj02035]
    JW4277 (fimA)
Secretion system [BR:ecj02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   JW4277 (fimA)
Bacterial motility proteins [BR:ecj02035]
 Pilus system
  Fimbrial proteins
   JW4277 (fimA)
SSDB
Motif
Pfam: Fimbrial FimA Glucodextran_B
Other DBs
NCBI-ProteinID: BAE78307
UniProt: P04128
Structure
Position
4547795..4548343
AA seq 182 aa
MKIKTLAIVVLSALSLSSTAALAAATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQV
RTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSAT
NVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQ
YQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaaaattaaaactctggcaatcgttgttctgtcggctctgtccctcagttctacagcg
gctctggccgctgccacgacggttaatggtgggaccgttcactttaaaggggaagttgtt
aacgccgcttgcgcagttgatgcaggctctgttgatcaaaccgttcagttaggacaggtt
cgtaccgcatcgctggcacaggaaggagcaaccagttctgctgtcggttttaacattcag
ctgaatgattgcgataccaatgttgcatctaaagccgctgttgcctttttaggtacggcg
attgatgcgggtcataccaacgttctggctctgcagagttcagctgcgggtagcgcaaca
aacgttggtgtgcagatcctggacagaacgggtgctgcgctgacgctggatggtgcgaca
tttagttcagaaacaaccctgaataacggaaccaataccattccgttccaggcgcgttat
tttgcaaccggggccgcaaccccgggtgctgctaatgcggatgcgaccttcaaggttcag
tatcaataa

DBGET integrated database retrieval system