KEGG   Escherichia coli K-12 W3110: JW5162
Entry
JW5162            CDS       T00068                                 

Symbol
lolD
Name
(GenBank) outer membrane-specific lipoprotein transporter subunit
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:7.6.2.-]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW5162 (lolD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5162 (lolD)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter
    JW5162 (lolD)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 RsgA_GTPase SbcC_Walker_B AAA_22 AAA_30 FtsK_SpoIIIE DUF87 AAA_23 MMR_HSR1 AAA_33 NACHT
Other DBs
NCBI-ProteinID: BAA35937
UniProt: P75957
Structure
Position
1178196..1178897
AA seq 233 aa
MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDT
PTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPA
EINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARN
ADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaataagatcctgttgcaatgcgacaacctgtgcaaacgctatcaggaaggcagtgtg
caaaccgatgtgctgcacaatgtcagtttcagcgtcggcgaaggtgaaatgatggcgatc
gtcggtagctctggttccggtaaaagtaccttgctgcacctgctgggcgggctggatacg
ccaacctccggcgatgtgatttttaatggtcagccaatgagcaaactgtcgtcggcagcg
aaagctgaactgcgcaaccagaagctgggctttatttatcagtttcaccacctgctgccg
gattttaccgccctggaaaacgtggctatgccgctgctgattggcaagaaaaagcccgct
gaaatcaacagccgtgcacttgagatgttaaaagcggtggggctggatcatcgtgcgaat
caccgcccatctgaactttctggcggcgaacgccagcgtgtggcgattgcccgtgcgctg
gtgaataacccgcgcctggtactggcggatgaacctaccggtaacctcgatgcgcgtaac
gccgacagcatcttccagttgcttggggaattgaatcgcttgcagggcaccgccttcctg
gtggttactcacgacctgcaactggcgaaacgtatgagccgccagttagaaatgcgtgat
ggtcgtctgacggcggaactgagcctgatgggggcggagtaa

DBGET integrated database retrieval system