KEGG   Escherichia coli K-12 W3110: JW5897Help
Entry
JW5897            CDS       T00068                                 

Gene name
yliA
Definition
(GenBank) fused predicted peptide transport subunits and ATP-binding components of ABC superfamily
  KO
K13892  glutathione transport system ATP-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW5897 (yliA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5897 (yliA)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Glutathione transporter
    JW5897 (yliA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 SMC_N AAA_16 AAA_21 AAA_29 AAA_30 Zeta_toxin CbiA IstB_IS21 RsgA_GTPase DUF87 TniB FtsK_SpoIIIE AAA_7 AAA_25 Sigma54_activat NACHT DUF3987 Hpr_kinase_C ResIII ATP-synt_ab DUF2075 AAA_26
Motif
Other DBs
NCBI-ProteinID: BAA35517
UniProt: P75796
Position
867975..869813
Genome map
AA seq 612 aa AA seqDB search
MLAVENLNIAFMQDQQKIAAVRNLSFSLQRGETLAIVGESGSGKSVTALALMRLLEQAGG
LVQCDKMLLQRRSREVIELSEQNAAQMRHVRGADMAMIFQEPMTSLNPVFTVGEQIAESI
RLHQNASREEAMVEAKRMLDQVRIPEAQTILSRYPHQLSGGMRQRVMIAMALSCRPAVLI
ADEPTTALDVTIQAQILQLIKVLQKEMSMGVIFITHDMGVVAEIADRVLVMYQGEAVETG
TVEQIFHAPQHPYTRALLAAVPQLGAMKGLDYPRRFPLISLEHPAKQAPPIEQKTVVDGE
PVLRVRNLVTRFPLRSGLLNRVTREVHAVEKVSFDLWPGETLSLVGESGSGKSTTGRALL
RLVESQGGEIIFNGQRIDTLSPGKLQALRRDIQFIFQDPYASLDPRQTIGDSIIEPLRVH
GLLPGKDAAARVAWLLERVGLLPEHAWRYPHEFSGGQRQRICIARALALNPKVIIADEAV
SALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVVERISHRVAVMYLGQIVEIGPRRAV
FENPQHPYTRKLLAAVPVAEPSRQRPQRVLLSDDLPSNIHLRGEEVAAVSLQCVGPGHYV
AQPQSEYAFMRR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcggttgaaaatctgaatattgcctttatgcaggaccagcagaaaatagctgcg
gtccgcaatctctcttttagtctgcaacgcggtgagacgctggcaattgttggcgaatcc
ggctccggtaagtcagtgactgcgttggcattgatgcgcctgttggaacaggcgggcggt
ttagtacagtgcgataaaatgctgttgcagcggcgcagtcgcgaagtgattgaacttagc
gagcagaacgctgcacaaatgcgccatgttcgcggtgcggatatggcgatgatatttcag
gagccgatgacatcgctgaacccggtatttactgtgggtgaacagattgccgaatcaatt
cgtctgcatcagaacgccagtcgtgaagaagcgatggtcgaggcgaagcggatgctggat
caggtacgcattcctgaggcacaaaccattctttcacgttatccgcatcaactctctggc
gggatgcgccagcgagtgatgattgcgatggcgctgtcatgccgcccggcggtgctgatt
gccgatgagccaaccaccgcgctggatgtcactattcaggcgcagatcctgcaattaatc
aaagtattgcaaaaagagatgtcgatgggcgttatctttatcactcacgatatgggcgtg
gtggcagagattgccgatcgggtactggtgatgtatcagggcgaggcggtggaaacgggt
accgtcgaacagatttttcatgcaccgcaacatccttacacccgtgcgctgttagctgct
gttccgcaacttggtgcgatgaaagggttagattatccccgacgtttcccgttgatatcg
cttgaacatccagcgaaacaggccccccccatcgagcagaaaacggtggtggatggcgaa
cctgttttacgagtgcgtaatcttgtcacccgtttccctttgcgcagcggtttgttgaat
cgcgtaacgcgggaagtgcatgccgttgagaaagtcagttttgatctctggcctggcgaa
acgctatcgctggtgggcgagtctggcagcggtaaatccactaccgggcgggcgttgctg
cgcctggtcgaatcgcagggcggcgaaattatctttaacggtcagcgaatcgataccttg
tcacccggcaaacttcaggcattacgccgggatattcagtttatttttcaggacccttac
gcttcgctggacccacgtcagaccatcggtgattcgattatcgaaccgctgcgtgtacac
ggtttattgccaggtaaagacgcggctgcacgcgttgcgtggttgctggagcgcgtgggc
ctgttacctgaacatgcctggcgttacccgcatgagttttccggcggtcagcgccagcgc
atctgcattgctcgcgcgttggcattgaatccaaaagtgatcattgccgacgaagccgtt
tcggcgctggatgtttctattcgcgggcagattatcaacttgttgctcgatctccagcgt
gatttcggcattgcgtatctgtttatctcccacgatatggcggtggtagagcggattagt
catcgtgtggcggtgatgtatctcgggcaaattgttgaaattggtccacggcgcgcggtc
ttcgaaaacccgcagcatccttatacgcgtaaattactggcggcagttccggtcgctgaa
ccgtcccgacaacgaccgcagcgtgtactgctgtcggacgatcttcccagcaatattcat
ctgcgtggcgaagaggtggcagccgtctcgttgcaatgcgtcgggccggggcattacgtc
gcacaaccacaatcagaatacgcattcatgcgtagataa

DBGET integrated database retrieval system