KEGG   Escherichia coli K-12 MG1655: b0015
Entry
b0015             CDS       T00007                                 

Gene name
dnaJ
Definition
(RefSeq) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eco03110]
    b0015 (dnaJ)
   03029 Mitochondrial biogenesis [BR:eco03029]
    b0015 (dnaJ)
Chaperones and folding catalysts [BR:eco03110]
 Heat shock proteins
  HSP40 / DNAJ
   b0015 (dnaJ)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    b0015 (dnaJ)
SSDB
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP DUF5351 Cytochrome_C7 TackOD1
Other DBs
NCBI-GeneID: 944753
NCBI-ProteinID: NP_414556
Pasteur: dnaJ
RegulonDB: ECK120000234
ECOCYC: EG10240
ASAP: ABE-0000054
UniProt: P08622
Structure
PDB: 
5NRO 1EXK 1BQ0 1BQZ 1XBL

Position
14168..15298
AA seq 376 aa
MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS
QKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAARGADLRYN
MELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQ
QTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAP
AGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPGETQTG
KLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNERQKQLLQELQESFGGPTGEHNSPRS
KSFFDGVKKFFDDLTR
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggctaagcaagattattacgagattttaggcgtttccaaaacagcggaagagcgtgaa
atcagaaaggcctacaaacgcctggccatgaaataccacccggaccgtaaccagggtgac
aaagaggccgaggcgaaatttaaagagatcaaggaagcttatgaagttctgaccgactcg
caaaaacgtgcggcatacgatcagtatggtcatgctgcgtttgagcaaggtggcatgggc
ggcggcggttttggcggcggcgcagacttcagcgatatttttggtgacgttttcggcgat
atttttggcggcggacgtggtcgtcaacgtgcggcgcgcggtgctgatttacgctataac
atggagctcaccctcgaagaagctgtacgtggcgtgaccaaagagatccgcattccgact
ctggaagagtgtgacgtttgccacggtagcggtgcaaaaccaggtacacagccgcagact
tgtccgacctgtcatggttctggtcaggtgcagatgcgccagggattcttcgctgtacag
cagacctgtccacactgtcagggccgcggtacgctgatcaaagatccgtgcaacaaatgt
catggtcatggtcgtgttgagcgcagcaaaacgctgtccgttaaaatcccggcaggggtg
gacactggagaccgcatccgtcttgcgggcgaaggtgaagcgggcgagcatggcgcaccg
gcaggcgatctgtacgttcaggttcaggttaaacagcacccgattttcgagcgtgaaggc
aacaacctgtattgcgaagtcccgatcaacttcgctatggcggcgctgggtggcgaaatc
gaagtaccgacccttgatggtcgcgtcaaactgaaagtgcctggcgaaacccagaccggt
aagctattccgtatgcgcggtaaaggcgtcaagtctgtccgcggtggcgcacagggtgat
ttgctgtgccgcgttgtcgtcgaaacaccggtaggcctgaacgaaaggcagaaacagctg
ctgcaagagctgcaagaaagcttcggtggcccaaccggcgagcacaacagcccgcgctca
aagagcttctttgatggtgtgaagaagttttttgacgacctgacccgctaa

DBGET integrated database retrieval system