KEGG   Escherichia coli K-12 MG1655: b0652Help
Entry
b0652             CDS       T00007                                 

Gene name
gltL
Definition
(RefSeq) glutamate/aspartate ABC transporter ATP binding subunit
  KO
K10004  glutamate/aspartate transport system ATP-binding protein [EC:7.4.2.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02020  Two-component system
Module
eco_M00230  Glutamate/aspartate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b0652 (gltL)
  09132 Signal transduction
   02020 Two-component system
    b0652 (gltL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0652 (gltL)
Enzymes [BR:eco01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     b0652 (gltL)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate/aspartate transporter [MD:M00230]
    b0652 (gltL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_16 AAA_29 Rad17 AAA_33 NTPase_1 DLIC AAA_15 cobW ATPase_2 AAA_18 AAA_30 ATPase AAA_23 AAA_24 Dynamin_N AAA_13 PhoH T2SSE IstB_IS21 Septin RNA12 AAA_7 PRK RNA_helicase NB-ARC S4 AAA_25
Motif
Other DBs
NCBI-GeneID: 945254
NCBI-ProteinID: NP_415185
Pasteur: gltL
RegulonDB: ECK120002351
ECOCYC: EG12663
ASAP: ABE-0002232
UniProt: P0AAG3 A0A387D437
Position
complement(684530..685255)
Genome map
AA seq 241 aa AA seqDB search
MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITV
DGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKL
LERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMV
ELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLAKIL
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgattaccctgaaaaatgtttcaaaatggtatggtcactttcaggtgctgaccgactgc
tcaaccgaagtgaaaaaaggcgaagtggtggtggtttgcggcccgtctggttccggcaaa
tcaacgctgattaaaaccgtcaacggcctcgaaccggtgcagcaaggtgaaatcaccgtc
gatggtatcgtggttaacgacaagaaaaccgatctggcaaagctgcgttcccgcgtcggg
atggtattccagcatttcgagctgttccctcatctgtcgattatcgaaaacctgaccctg
gcgcaggtgaaagtgcttaaacgcgataaagcgccggctcgtgaaaaagccctgaaactg
ctggagcgtgtcgggctttctgctcacgccaataagtttccggcgcagctttccggcggt
cagcagcagcgtgtggcaatcgctcgcgcgttgtgtatggatcctattgcgatgctgttt
gacgaaccgacatcggcgctggatccggagatgatcaacgaagtactggacgtgatggtg
gaactggcgaacgaaggaatgaccatgatggtggtgacccacgaaatgggctttgcccgt
aaagtggcgaatcgggtgatctttatggacgagggtaaaattgtcgaagactcgccgaaa
gacgctttcttcgatgatccgaaatcggaccgcgcaaaagacttcctcgcgaaaatcctg
cattaa

DBGET integrated database retrieval system