KEGG   Escherichia coli K-12 MG1655: b0681
Entry
b0681             CDS       T00007                                 

Symbol
chiP
Name
(RefSeq) chitobiose outer membrane channel
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: OprD
Other DBs
NCBI-GeneID: 945296
NCBI-ProteinID: NP_415207
Pasteur: ybfM
RegulonDB: ECK120002973
ECOCYC: G6370
ASAP: ABE-0002323
UniProt: P75733
Position
708334..709740
AA seq 468 aa
MRTFSGKRSTLALAIAGVTAMSGFMAMPEARAEGFIDDSTLTGGIYYWQRERDRKDVTDG
DKYKTNLSHSTWNANLDFQSGYAADMFGLDIAAFTAIEMAENGDSSHPNEIAFSKSNKAY
DEDWSGDKSGISLYKAAAKFKYGPVWARAGYIQPTGQTLLAPHWSFMPGTYQGAEAGANF
DYGDAGALSFSYMWTNEYKAPWHLEMDEFYQNDKTTKVDYLHSFGAKYDFKNNFVLEAAF
GQAEGYIDQYFAKASYKFDIAGSPLTTSYQFYGTRDKVDDRSVNDLYDGTAWLQALTFGY
RAADVVDLRLEGTWVKADGQQGYFLQRMTPTYASSNGRLDIWWDNRSDFNANGEKAVFFG
AMYDLKNWNLPGFAIGASYVYAWDAKPATWQSNPDAYYDKNRTIEESAYSLDAVYTIQDG
RAKGTMFKLHFTEYDNHSDIPSWGGGYGNIFQDERDVKFMVIAPFTIF
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcgtacgtttagtggcaaacgtagtacgctggcgctggctatcgccggtgttacagca
atgtcgggctttatggcaatgccggaggctcgcgccgaaggattcatcgacgattcaacc
ttaaccggcggtatctattactggcagcgtgaacgcgaccgtaaagatgttaccgacggc
gacaaatacaaaaccaacctttctcactccacctggaatgccaacctcgattttcagtcc
ggttatgctgctgatatgttcggccttgatattgctgcgtttacggcgattgaaatggcg
gaaaacggcgacagctcccacccgaacgaaatcgcgttttcaaaaagtaataaagcctat
gacgaagactggtccggcgacaaaagcggtataagcctgtataaagctgcggccaaattt
aaatacggtccggtttgggcgagggcaggttacattcagccaactggtcaaacgctgtta
gcgccgcactggagctttatgccaggtacttatcagggggcggaagccggggcgaatttt
gattacggcgatgctggtgcgttgagtttctcctacatgtggaccaacgaatacaaagcg
ccgtggcatctggaaatggatgagttttatcagaacgataaaaccaccaaagttgattat
ctgcactcctttggggcgaaatacgacttcaaaaataacttcgtactggaagcggcattt
ggtcaggcggaagggtatatcgatcaatattttgccaaagccagctacaaatttgatatc
gccggtagcccgttaaccaccagctaccagttctacggtacccgagataaagttgacgat
cgcagcgtcaacgacctttatgacggcaccgcctggctgcaagcgttgacctttggttac
cgggcggctgacgtagtggatttgcgcctcgaaggcacctgggttaaggctgacggtcag
cagggatacttcctgcaacgtatgactccaacctacgcttcctcaaacggtcgcctggat
atctggtgggataaccgttctgacttcaacgccaacggcgaaaaagcggtcttcttcggt
gcgatgtatgacctgaaaaactggaatcttccaggcttcgccatcggcgcttcctacgtt
tacgcatgggatgctaaacctgcgacctggcagagcaatccggatgcgtactacgacaaa
aaccggactattgaagagtctgcctacagcctggatgcggtctataccattcaggacggt
cgcgccaaaggcacgatgttcaaactgcatttcaccgaatacgacaaccactccgacatc
ccaagctggggcggtggttacggcaacatcttccaggatgagcgtgacgtgaaatttatg
gtaatcgcaccattcaccatcttctga

DBGET integrated database retrieval system