KEGG   Escherichia coli K-12 MG1655: b0779
Entry
b0779             CDS       T00007                                 

Gene name
uvrB
Definition
(RefSeq) excision nuclease subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    b0779 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eco03400]
    b0779 (uvrB)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     b0779 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      b0779 (uvrB)
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD AAA_30 UB2H IF2_N
Other DBs
NCBI-GeneID: 945385
NCBI-ProteinID: NP_415300
Pasteur: uvrB
RegulonDB: ECK120001051
ECOCYC: EG11062
ASAP: ABE-0002658
UniProt: P0A8F8
Structure
PDB: 
1QOJ 1E52

Position
813526..815547
AA seq 673 aa
MSKPFKLNSAFKPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPT
MVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIE
QMRLSATKAMLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMIIDQRAILRRLAELQ
YARNDQAFQRGTFRVRGEVIDIFPAESDDIALRVELFDEEVERLSLFDPLTGQIVSTIPR
FTIYPKTHYVTPRERIVQAMEEIKEELAARRKVLLENNKLLEEQRLTQRTQFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGMYRGDRARKET
LVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYELEKSGGDVVDQVVRPTGLLD
PIIEVRPVATQVDDLLSEIRQRAAINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDI
DTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIG
RAARNVNGKAILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALG
QNIAKTKAKGRGKSRPIVEPDNVPMDMSPKALQQKIHELEGLMMQHAQNLEFEEAAQIRD
QLHQLRELFIAAS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgagtaaaccgttcaaactgaattccgcttttaaaccttctggcgatcagccagaggcg
attcgacgtctcgaagaggggctggaagatggcctggcgcaccagacgttacttggcgtg
actggctcagggaaaaccttcaccattgccaatgtcattgctgaccttcagcgcccaacc
atggtacttgcgcccaacaaaacgctggcggcccagctgtatggcgaaatgaaagagttc
ttcccggaaaacgcggtggaatatttcgtttcctactacgactactatcagccggaagcc
tatgtaccgagttccgacactttcattgagaaagatgcctcggttaacgaacatattgag
cagatgcgtttgtccgccaccaaagcgatgctggagcggcgtgatgtggttgtggtggcg
tctgtttccgcgatttatggtctgggcgatcctgatttatatctcaagatgatgctccat
ctcacggtcggtatgattatcgatcagcgcgcgattctgcgccgactggcggagctgcaa
tacgctcgtaatgatcaagcattccagcgtggtactttccgcgttcgtggcgaggtgata
gatatcttcccggcagaatcggatgacattgcacttcgcgtggaactgtttgacgaggaa
gtggaacgattgtcgttatttgacccgctgaccgggcagattgtttccactattccacgt
tttaccatctacccgaaaacgcactacgtcacaccgcgcgagcgcatcgtacaggcgatg
gaggagatcaaagaagagctggccgccagacgcaaagtgctgttggaaaacaacaaactg
ctggaagagcagcggctgacccagcgtacccagtttgatctggagatgatgaacgagctg
ggctactgttcggggattgaaaactactcgcgcttcctctccggtcgtggaccgggtgag
ccaccgccgacgctgtttgattacctgcctgccgatgggctgctggtcgtcgatgaatct
cacgtcaccattccacaaattggcggcatgtatcgcggtgaccgggcgcgtaaagagaca
ctggtggagtacggcttccgcctgccatcagcgctggataaccgtccgcttaagtttgaa
gagttcgaagcattagcgccgcaaaccatctatgtttcggcgacgccgggtaattacgag
ctggaaaaatccggcggcgatgtggtggatcaggtggtgcgtccaaccggattgcttgac
ccgattatcgaagtgcggccggtggcgacacaggttgatgatcttctttcggagattcgt
cagcgagcggcaattaacgaacgcgtactggtcaccacactgaccaagcggatggcggaa
gatcttaccgaatatctcgaagaacatggcgagcgcgtgcgttatcttcactcagatatc
gacaccgtcgaacgtatggagattatccgcgacttgcgtctgggtgagttcgacgtgctg
gtagggatcaacttactgcgcgaaggtctggatatgccggaagtgtcgctggtggcgatc
ctcgacgctgacaaagaaggcttcctgcgttccgaacgttcgttgatccagaccattggt
cgtgcggcacgtaacgttaacggtaaagcgattctctacggcgataagatcaccccatca
atggcgaaagcgattggcgaaaccgaacgtcgccgtgagaaacagcagaagtacaacgag
gaacacggaattacgccgcaaggcttgaacaagaaagtggtcgatatcctggcgctgggg
cagaacattgccaaaaccaaagcgaagggcagaggaaaatcgcgcccgattgttgagccg
gataatgtgccgatggatatgtcgcctaaagcgttgcagcagaaaatccatgagctggaa
gggttgatgatgcaacacgcgcagaatctggagttcgaagaagcggcgcaaattcgtgac
cagttgcatcagctgcgtgagctgtttatcgcggcatcgtaa

DBGET integrated database retrieval system