KEGG   Escherichia coli K-12 MG1655: b0855
Entry
b0855             CDS       T00007                                 
Symbol
potG
Name
(RefSeq) putrescine ABC transporter ATP binding subunit
  KO
K11076  putrescine transport system ATP-binding protein [EC:7.6.2.16]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b0855 (potG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0855 (potG)
Enzymes [BR:eco01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.16  ABC-type putrescine transporter
     b0855 (potG)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putrescine transporter
    b0855 (potG)
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 RsgA_GTPase SMC_N AAA_16 AAA_22 AAA_28 AAA_29 Rad17 ATP-synt_ab MMR_HSR1 AAA_33 AAA_25 AAA_23 G-alpha
Other DBs
NCBI-GeneID: 945476
NCBI-ProteinID: NP_415376
Pasteur: potG
RegulonDB: ECK120001578
ECOCYC: EG11630
ASAP: ABE-0002915
UniProt: P31134
Position
894991..896124
AA seq 377 aa
MNDAIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKST
LLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDK
LPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGAL
DKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEH
PTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPE
KIMLCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWG
DEVRLCWEVDSCVVLTV
NT seq 1134 nt   +upstreamnt  +downstreamnt
gtgaatgacgctatccctcgcccgcaggcgaaaacccgtaaggcgctgacgccgctatta
gaaatccgcaacctgaccaaatcctacgatggtcaacatgcggtggatgatgtcagcctg
accatctacaaaggtgaaatcttcgcgctgctgggcgcatccggctgtggcaagtccacg
ctgctgcgtatgctggcaggtttcgaacaaccttctgccggacagataatgcttgatggc
gtcgatttgtcacaggttccgccttacctgcgccccatcaatatgatgtttcagtcttac
gcgctgtttccgcatatgaccgtggaacagaacatcgcttttggcctgaaacaggacaaa
ctaccgaaagcggaaattgccagccgggtcaatgagatgctcggcctggtgcatatgcag
gagttcgccaaacgcaaaccgcatcagctttccggtggtcagcgacaacgtgtggccctg
gcccgaagccttgcgaagcgcccgaaactattactgctcgatgagccgatgggcgcgctg
gataaaaagctgcgtgacaggatgcagcttgaagtggtggatattctggagcgcgtcggt
gtgacttgtgtgatggtcacccacgatcaggaagaggcgatgaccatggcggggcgcatc
gccattatgaatcgtgggaaatttgtccagattggcgaaccggaagagatctacgagcat
ccgactacccgctatagcgccgaatttattggctcggtaaacgtctttgaaggcgtactc
aaagagcgtcaggaagatggcctggtgcttgattcgccggggctggtgcatccactgaaa
gtcgacgcggatgcctcggtggtcgataacgtgccggtacatgtggcgctgcgcccggaa
aaaatcatgctttgcgaagagccgcccgccaatggttgtaacttcgcggtgggggaggtg
atacacattgcctatctcggcgatctttcggtgtatcacgttcgtctgaaaagtgggcag
atgattagcgcccagctacaaaacgcccatcgtcatcgtaaagggttaccgacctggggc
gacgaagtgcgtttgtgctgggaagtggacagctgtgtggtgctgacggtttaa

DBGET integrated database retrieval system