KEGG   Escherichia coli K-12 MG1655: b0855Help
Entry
b0855             CDS       T00007                                 

Gene name
potG
Definition
(RefSeq) putrescine ABC transporter ATPase
  KO
K11076  putrescine transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b0855 (potG)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    b0855 (potG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 RsgA_GTPase SMC_N AAA_16 AAA_28 AAA_22 AAA_29 AAA_33 ATP-synt_ab Rad17 MMR_HSR1 AAA_23 G-alpha
Motif
Other DBs
NCBI-GeneID: 945476
NCBI-ProteinID: NP_415376
Pasteur: potG
RegulonDB: ECK120001578
ECOCYC: EG11630
ASAP: ABE-0002915
UniProt: P31134
Position
894991..896124
Genome map
AA seq 377 aa AA seqDB search
MNDAIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKST
LLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDK
LPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGAL
DKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEH
PTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPE
KIMLCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWG
DEVRLCWEVDSCVVLTV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgacgctatccctcgcccgcaggcgaaaacccgtaaggcgctgacgccgctatta
gaaatccgcaacctgaccaaatcctacgatggtcaacatgcggtggatgatgtcagcctg
accatctacaaaggtgaaatcttcgcgctgctgggcgcatccggctgtggcaagtccacg
ctgctgcgtatgctggcaggtttcgaacaaccttctgccggacagataatgcttgatggc
gtcgatttgtcacaggttccgccttacctgcgccccatcaatatgatgtttcagtcttac
gcgctgtttccgcatatgaccgtggaacagaacatcgcttttggcctgaaacaggacaaa
ctaccgaaagcggaaattgccagccgggtcaatgagatgctcggcctggtgcatatgcag
gagttcgccaaacgcaaaccgcatcagctttccggtggtcagcgacaacgtgtggccctg
gcccgaagccttgcgaagcgcccgaaactattactgctcgatgagccgatgggcgcgctg
gataaaaagctgcgtgacaggatgcagcttgaagtggtggatattctggagcgcgtcggt
gtgacttgtgtgatggtcacccacgatcaggaagaggcgatgaccatggcggggcgcatc
gccattatgaatcgtgggaaatttgtccagattggcgaaccggaagagatctacgagcat
ccgactacccgctatagcgccgaatttattggctcggtaaacgtctttgaaggcgtactc
aaagagcgtcaggaagatggcctggtgcttgattcgccggggctggtgcatccactgaaa
gtcgacgcggatgcctcggtggtcgataacgtgccggtacatgtggcgctgcgcccggaa
aaaatcatgctttgcgaagagccgcccgccaatggttgtaacttcgcggtgggggaggtg
atacacattgcctatctcggcgatctttcggtgtatcacgttcgtctgaaaagtgggcag
atgattagcgcccagctacaaaacgcccatcgtcatcgtaaagggttaccgacctggggc
gacgaagtgcgtttgtgctgggaagtggacagctgtgtggtgctgacggtttaa

DBGET integrated database retrieval system