KEGG   Escherichia coli K-12 MG1655: b0949
Entry
b0949             CDS       T00007                                 
Symbol
uup
Name
(RefSeq) ATP-binding protein Uup
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b0949 (uup)
Transporters [BR:eco02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    b0949 (uup)
SSDB
Motif
Pfam: ABC_tran ABC_tran_CTD AAA_21 SMC_N ABC_tran_Xtn AAA_22 AAA_15 AAA_29 AAA_16 RsgA_GTPase AAA_33 AAA_30 AAA_23 TsaE AAA_18 MMR_HSR1 AAA RNA_helicase AAA_28 AAA_24 NACHT ATP-synt_ab AAA_14 AAA_25 PduV-EutP AAA_7 AAA_5 Rad17 ATPase_2 MobB NB-ARC DUF815 Dynamin_N AAA_13 T2SSE AAA_19 DUF948 Ploopntkinase3 FapA
Other DBs
NCBI-GeneID: 945566
NCBI-ProteinID: NP_415469
Pasteur: uup
RegulonDB: ECK120003089
ECOCYC: G6489
ASAP: ABE-0003213
UniProt: P43672
Structure
Position
1009964..1011871
AA seq 635 aa
MSLISMHGAWLSFSDAPLLDNAELHIEDNERVCLVGRNGAGKSTLMKILNREQGLDDGRI
IYEQDLIVARLQQDPPRNVEGSVYDFVAEGIEEQAEYLKRYHDISRLVMNDPSEKNLNEL
AKVQEQLDHHNLWQLENRINEVLAQLGLDPNVALSSLSGGWLRKAALGRALVSNPRVLLL
DEPTNHLDIETIDWLEGFLKTFNGTIIFISHDRSFIRNMATRIVDLDRGKLVTYPGNYDQ
YLLEKEEALRVEELQNAEFDRKLAQEEVWIRQGIKARRTRNEGRVRALKAMRRERGERRE
VMGTAKMQVEEASRSGKIVFEMEDVCYQVNGKQLVKDFSAQVLRGDKIALIGPNGCGKTT
LLKLMLGQLQADSGRIHVGTKLEVAYFDQHRAELDPDKTVMDNLAEGKQEVMVNGKPRHV
LGYLQDFLFHPKRAMTPVRALSGGERNRLLLARLFLKPSNLLILDEPTNDLDVETLELLE
ELIDSYQGTVLLVSHDRQFVDNTVTECWIFEGGGKIGRYVGGYHDARGQQEQYVALKQPA
VKKTEEAAAAKAETVKRSSSKLSYKLQRELEQLPQLLEDLEAKLEALQTQVADASFFSQP
HEQTQKVLADMAAAEQELEQAFERWEYLEALKNGG
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtcattaatcagtatgcatggcgcatggctgtcgttcagcgacgcgccgcttctcgat
aacgcagaactgcatatcgaagataacgaacgtgtttgtctggtgggccgcaacggcgca
ggcaaatcgacgttaatgaaaatcctcaaccgtgaacaagggctggatgacggtcgcatt
atttacgagcaagatttgattgtagcgcgtctgcaacaggatccgccgcgtaacgttgag
ggtagcgtttatgatttcgttgccgaaggcattgaagaacaagcggaatatctgaaacgc
tatcacgatatttcgcgcctggtgatgaacgacccgagcgagaaaaatctcaacgaactg
gcgaaggttcaggaacagctggatcaccacaacctgtggcagctggaaaaccgcatcaac
gaagtgctggcgcaactggggttagatcctaacgttgcgctgtcgtcgctttccggcggc
tggttgcgtaaagcggcattaggacgcgcgctggtgagtaatccgcgcgtgctgttgctt
gatgaaccgacaaaccacctggatattgaaaccatcgactggctggaagggtttttgaaa
actttcaacgggacgattattttcatctcccacgaccgttcgtttatccgcaatatggcg
acgcgcattgttgatctcgatcgcggcaagctggtgacctatccagggaattacgaccag
tacctgctggaaaaagaagaagccctgcgcgtggaagaattacaaaatgccgagttcgat
cgcaaactggcgcaggaagaggtgtggatccgccaggggatcaaagcacgccgtacccgt
aatgaaggccgcgtacgcgccctgaaagcgatgcgtcgcgaacgtggtgaacgtcgcgaa
gtgatgggtaccgcaaagatgcaggtggaagaggccagccgctccggtaaaatcgttttc
gaaatggaagacgtttgctaccaggttaacggtaagcaactggtgaaagatttttctgcc
caggttctacgtggcgacaaaattgccctgattggtccgaatgggtgcggcaaaaccacg
ctgctaaaactgatgctcggtcagcttcaagcggacagcgggcgtattcacgttggcacc
aaactggaagtggcttatttcgatcagcaccgcgcggaactggatcccgataaaacggtg
atggataaccttgccgaaggtaagcaagaggtgatggttaacggcaagccacgccacgta
ttgggctatttgcaggactttctgttccatccgaaacgggcgatgacgccggtacgtgcg
ctttctggcggtgagcggaaccgcttgctgctggcgcgtttgttcctcaaaccaagcaac
ttattgattcttgacgaaccgaccaacgatcttgatgtcgaaacgctggaactgctggaa
gaactgatcgacagctatcagggcacggtattgctggttagccacgatcgtcagtttgtc
gataacaccgttacagaatgttggatcttcgaaggcggcggtaaaattggtcgttatgtc
ggcggttatcatgatgcccgtggtcagcaagagcagtatgtggcgctcaaacagcctgcg
gtgaaaaaaaccgaagaagccgccgcggcaaaagcagaaactgtaaaacgcagcagtagc
aaactaagctataaattgcagcgcgaactggagcagctaccgcaattgctcgaagatctg
gaggcgaagctggaagccctacagacgcaagtggcggatgcttccttcttcagtcagccg
catgagcagacgcaaaaagtgcttgctgatatggctgctgcagagcaggagctggagcaa
gcctttgaacgctgggagtatcttgaagcgttaaaaaatggtggctga

DBGET integrated database retrieval system