KEGG   Escherichia coli K-12 MG1655: b3070
Entry
b3070             CDS       T00007                                 

Gene name
nfeF
Definition
(RefSeq) NADPH-dependent ferric chelate reductase
  KO
K07229  ferric-chelate reductase (NADPH) [EC:1.16.1.9]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b3070 (nfeF)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.9  ferric-chelate reductase (NADPH)
     b3070 (nfeF)
SSDB
Motif
Pfam: FAD_binding_9 SIP
Other DBs
NCBI-GeneID: 947582
NCBI-ProteinID: NP_417541
Pasteur: yqjH
RegulonDB: ECK120004147
ECOCYC: G7593
ASAP: ABE-0010079
UniProt: Q46871
Position
complement(3215727..3216491)
AA seq 254 aa
MNNTPRYPQRVRNDLRFRELTVLRVERISAGFQRIVLGGEALDGFTSRGFDDHSKLFFPQ
PDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFFIHDGGVASGWAMQAQP
GDKLTVAGPRGSLVVPEDYAYQLYVCDESGMPALRRRLETLSKLAVKPQVSALVSVRDNA
CQDYLAHLDGFNIEWLAHDEQAVDARLAQMQIPADDYFIWITGEGKVVKNLSRRFEAEQY
DPQRVRAAAYWHAK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaataacaccccccgctacccgcagcgcgttcgcaatgatctgcgcttccgtgaactg
actgtgttacgcgttgagcgcatcagcgccggttttcagcgcattgtcctcggcggcgag
gcgctggacggttttacatcgcgtggctttgacgatcacagcaaactcttctttcctcaa
cctgacgctcactttgtgccgccaacggtaacggaagagggcatcgtctggccggaagga
ccacgcccaccgtcgcgtgactatacgccgctgtatgacgaactacgccatgaactggcg
attgatttctttattcacgacggtggggtcgccagcggctgggcgatgcaggcgcaaccg
ggcgataaacttacggtggcaggtccgcgcggttcgctggtggtgccggaagattacgcg
tatcagctgtatgtctgcgatgaatccggaatgcctgcattgcgccgccgcctggaaacg
ttgagcaaacttgccgttaaaccgcaagttagtgcgctggttagcgtgcgggataacgcc
tgtcaggattatctcgcgcaccttgatggttttaatatcgaatggctggcacatgatgag
caggcggtagatgcgcgtctggcgcagatgcaaatccctgccgatgattacttcatctgg
ataaccggcgaaggtaaagtcgttaagaatttaagccgccgctttgaagcggaacagtat
gacccacagcgggtacgtgcagcggcttactggcacgcaaagtaa

DBGET integrated database retrieval system