KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1CoBM33
Entry
APECO1_O1CoBM33   CDS       T00425                                 

Gene name
traB
Definition
(GenBank) TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1CoBM33 (traB)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1CoBM33 (traB)
SSDB
Motif
Pfam: TrbI CALCOCO1 CtIP_N ATG16 HAUS6_N
Other DBs
NCBI-ProteinID: ABD51603
UniProt: A0A0H2XKV2
Position
pAPEC-O1-ColBM:22236..23663
AA seq 475 aa
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDT
TFDDKVRQHATTEMQVTAAQMQKQYEEIRRELNVLNKQRGDDQRRIEKLGQDNAALAEQV
KALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTP
PPQVTYQSVPVPNRIQRKVFTRNEGKQGPSLPYIPSGSFAKAMLIEGADANASVTGNEST
VPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAIVRTRNISCLKDGKTIDMPIK
GHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLGATAAYGAGDV
LKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALERT
QSRAEEDNPESPVPVPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGSQGGGNDGK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggccagtatcaataccattgtgaaacgcaagcagtacctgtggctggggattgtggtt
gtcggtacagcctccgcgattggtggggcactgtatctgtctgatgtggacatgtccggt
aacggtgaaaccgtggctgaacaggagcctgtgccggatatgaccggtgtggtggatacg
acctttgatgacaaggtgcgtcagcatgccaccaccgagatgcaggtgacggcagcgcag
atgcagaagcagtatgaggaaatccgtcgtgagctgaatgttctgaacaaacagcgcggt
gatgaccagcgtcgtattgaaaagttgggacaggacaatgccgccctggcagagcaggta
aaagccctgggtgctaatcccgtcacggcgaccggtgagcctgtaccgcagatgcctgcc
tcaccgcccggcccggaaggcgaaccacagccaggaaacacccccgtatccttcccgccg
cagggcagcgttgctgttccaccgccgacggcgttttatcccgggaatggtgtcacgcca
ccaccacaggtgacgtaccagtctgtgccggtgcctaaccggatacagcgtaaggtgttt
acccgtaatgagggaaaacagggaccatcactgccgtacattccgtcaggaagttttgcg
aaagccatgctgattgaaggggcggatgccaatgcctctgtcaccggtaatgaatccacg
gtgccgatgcagctgcgtatcaccggcctggtggaaatgccgaacagcaagacgtatgac
gcaacgggatgttttgtgggtctggaagcctggggggatgtgtccagtgagcgtgccatt
gtacgcacccgcaatatcagttgcctgaaggacggcaaaactattgatatgccgattaag
gggcatgtcagcttccggggtaaaaacggtatcaagggcgaagtggtgatgcgtaacggc
aaaatcctcggctgggcatggggcgcgggatttgttgacggtatcggtcagggaatggag
cgcgcctcccagccggctgtcgggctgggtgccacagccgcttacggggctggtgatgtc
ctgaaaatgggtatcggtggcggcgcatcgaaagccgcacagacgctcagtgactactac
atcaaacgtgccgaacagtatcacccggtgataccgattggtgcgggcaacgaagtgacc
gtggtgttccaggacggcttccagctgaaaaccgtggaagagatggcgctggaacgcacg
cagagcagagcggaagaagacaatccggaaagtccggttcctgttccgccatcggctgaa
agtcatcttaacggctttaatactgaccagatgctgaagcagctgggcaacctgaatccg
cagcagtttatgtccggcagccagggagggggcaacgatggcaaataa

DBGET integrated database retrieval system