KEGG   Escherichia coli APEC O1 (APEC): APECO1_O1R29
Entry
APECO1_O1R29      CDS       T00425                                 
Symbol
trhN
Name
(GenBank) TrhN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
ecv  Escherichia coli APEC O1 (APEC)
Brite
KEGG Orthology (KO) [BR:ecv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecv02044]
    APECO1_O1R29 (trhN)
Secretion system [BR:ecv02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APECO1_O1R29 (trhN)
SSDB
Motif
Pfam: TraN DUF865
Other DBs
NCBI-ProteinID: ABF67712
UniProt: A0A0H2XKD8
Position
pAPEC-O1-R:34241..37429
AA seq 1062 aa
MKLRKTITSAIIASMVANTMSWAFYVTLINMVMTPRVYAADAIFDQLENNFNLANPNANR
NATTSAQDIVEKYKNADSGENVSGKITEKYVGKAESANLNLGKYGAGNSNESVMKNAASD
GKSIGSAVQLPSMSGGTINSNYTKEGAKLLSRDANGNIGISSNPNTTPGTKTNTGEIFSS
EQKHSDIKFNAADRYGDEDGFVNDIKNRKSQLFDAQSYDGVAYRTLVNANKDNPASSVKP
NDPMFTAGRNEITNAVAGTGNWLQNCNVETSKKTVTTHYPDYKEFYCNSPKQDNFSSCTI
TRDFSVPVYISGGNGDMSMCGDNCVRIWFGRRDDNYWSDGVFDNELTLKFHPDAKLASAK
IVNAEWDDHMRVTLDGTQIFAHIDGAYRESDYPAPKGSWELKKSWKLDKVYDVTEKVRKS
VYEEPDREVTMASRVWVGGGGEGYFEVELTFENMKLEDKHVQEPAGCYDAVQTPNTFCRF
DRFKDMDVGTKRLPESVLSMAKPLYEGDKGFLTWKTNLEGYFCDPLAKDKICSYDASGKI
MKDANGKDLCYNYEEIKSMPDACSSYKNDAACVLDKQTCAEGWFDEGTNSCYMYEQKYTC
DRGKDVVREVESSTNACVGMIPCSGGTCETGPKEENNDFGKVAAYSNMVQYMQGEAKCED
PNDANSCSVFEGKPEWCGRSVGFVNGLAKTDCCEAPQGTAGALEGIMLAGSMIRNTNWTR
VNAQLIKWTGGDTGTWASMSNAVGEWTASAGKTVGQMWNNVTSSLTSVYENVAGNLSRAV
GSSATSGGAGGAGQLAQETMSSFGIGQLKQMAMKKAYELLPDTVRDFVFKNVATTGGEVV
FSAAVQNFMLALNVIGWIYTAYQVTKMLLEMLVACDQKEMEASIHKNQKSCFTLDTERCV
KYLNVGFTKKCVKKATDMCCYNSMLSRVIMQQAYPQLGIDPVASNCVGLSIKQIQQLDFD
KIDLTEWINDAVQVGEVPDQYSKFSEESIVENLPFQNENYQLPSERTKEAMGGEENMIKA
RQENAQAIKEENVDCSYLPRPAICEVGSTTLDPVTGKQLPKY
NT seq 3189 nt   +upstreamnt  +downstreamnt
gtgaaacttagaaaaacaatcacctcagcgattattgcatcaatggttgccaatactatg
agttgggctttttatgtcacactcataaacatggtaatgacaccacgtgtttacgctgct
gacgctatatttgaccagctcgaaaataattttaaccttgcaaatcctaacgcaaatcgc
aatgcaaccaccagtgctcaggacattgtggagaaatacaagaacgcggattcaggcgag
aatgtcagtgggaagatcaccgagaaatacgtgggtaaagccgaatccgctaatcttaat
ctcgggaagtatggggcagggaactctaatgaaagtgtcatgaaaaatgccgcatccgat
ggaaagtctattggtagcgccgtacaactgccgagtatgtctggagggacaatcaattca
aactacaccaaggaaggggcaaagctgctctctcgtgatgctaatggcaacattggtata
agcagtaatcccaatactactcctggaaccaaaacaaatacgggagagattttcagctca
gagcaaaagcacagcgatataaagttcaacgccgcagatcgttatggggatgaggatggc
tttgttaacgatataaagaatcggaaaagccagttatttgatgctcaaagttatgatggc
gttgcctaccgcaccctcgtaaatgctaacaaggacaacccggcatcgtctgtaaagcct
aacgatcccatgtttactgcggggagaaatgagataaccaatgctgttgctggtactgga
aactggcttcagaactgtaatgttgagacctccaaaaaaacagtaaccacacactatcct
gattacaaagagttctactgtaactcgcctaagcaagataacttcagcagctgcacgata
actcgtgacttctctgttcctgtatacatttcaggcggaaacggagacatgtcgatgtgc
ggcgataattgtgtgcgtatatggtttggtcgccgtgatgacaactactggagtgacggg
gtatttgataacgaactgacattaaaattccatccggatgcaaaattggcctcagcaaag
attgttaacgcggagtgggatgaccacatgcgggtaacacttgatggcacgcagattttt
gctcacatagatggtgcatatcgagaaagtgactatccggctccaaagggatcttgggag
ttaaaaaaatcgtggaaactcgacaaagtatacgatgtaactgaaaaggtcagaaaatca
gtttatgaagaacctgatcgtgaagtgacaatggcatccagagtctgggttggtggggga
ggtgaagggtactttgaggttgagctgacgtttgaaaatatgaagctcgaagataagcac
gtccaggaaccagctggttgttacgatgctgtacaaacaccaaatacattctgccgtttc
gatcggtttaaagatatggatgttggcacgaagcggcttccggaaagcgtgctttctatg
gcaaagccgctgtatgaaggcgataaaggctttcttacctggaagactaaccttgaaggc
tatttttgtgatccattggctaaagacaagatttgctcttatgacgctagtgggaaaatt
atgaaagacgctaatggaaaggacctctgttacaactacgaagaaattaagagtatgcct
gatgcatgtagttcttataaaaatgatgcagcatgtgtactcgataaacaaacatgtgca
gagggttggttcgatgagggcactaacagctgctacatgtatgaacagaaatacacctgt
gacagaggtaaggatgtagttcgtgaggttgaatcttctacaaatgcctgtgttggcatg
atcccatgttctggaggaacatgcgaaactgggccaaaggaagagaacaacgattttgga
aaagttgcggcttattcaaacatggttcagtacatgcagggcgaagccaaatgcgaagac
cctaacgatgccaattcctgttctgtctttgaaggaaaacctgaatggtgtggtcgttca
gtaggctttgtaaatggcctggcaaagacggactgctgcgaagcaccgcagggaaccgca
ggagcacttgaaggtatcatgcttgccggatctatgatcagaaacactaactggaccaga
gttaatgctcagctaataaaatggaccggcggtgatacaggtacatgggcttctatgtcc
aatgcggtcggtgagtggactgcatcagctggtaaaacagtagggcaaatgtggaacaat
gtcacgagctccttaacgagcgtatatgaaaacgtcgctggtaatctaagcagggcagtt
gggtcttccgcaacttctggaggggcaggaggtgctggccagttggcacaggaaacaatg
tccagcttcggtataggtcagcttaagcagatggcaatgaagaaagcctacgaattgcta
ccagatacagttcgagactttgtctttaagaacgttgctactaccggaggagaggttgtc
ttctcggctgcggttcaaaactttatgcttgcattaaacgtgatcggttggatttataca
gcctatcaggtcactaaaatgcttttagaaatgttggtagcatgcgaccagaaagagatg
gaagcttctattcataagaatcaaaaatcctgttttacattagatacggaacgatgcgtc
aaatatctgaatgttggtttcacaaagaaatgcgttaaaaaagcaacagacatgtgctgt
tataattccatgttgtcacgcgttattatgcaacaagcttatccgcaattaggaatagac
cctgtcgcctctaattgcgtggggctatcaataaagcaaatacagcaactggatttcgat
aaaattgatctgacggagtggattaatgatgcagttcaggtaggagaagttcctgatcaa
tattcaaaattctccgaagaatcaattgtggaaaacttaccattccagaatgagaactat
caacttccatcagaacgtaccaaggaagcaatgggcggtgaagaaaatatgataaaggcc
agacaagaaaatgctcaggctataaaagaggaaaatgtagattgtagctatttacctcga
ccggccatatgtgaggtaggttcaactacgctggatccggttacgggcaagcagttgccg
aaatattga

DBGET integrated database retrieval system