KEGG   Edwardsiella ictaluri: NT01EI_0686
Entry
NT01EI_0686       CDS       T00912                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
eic  Edwardsiella ictaluri
Pathway
eic00230  Purine metabolism
eic01100  Metabolic pathways
eic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NT01EI_0686
Enzymes [BR:eic01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     NT01EI_0686
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ACR67908
UniProt: C5B7N1
Position
complement(671483..673774)
AA seq 763 aa
MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGNVTAIDTREAESMPGV
EAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFGDGVAIVVARDLLSAER
AAARVQVSYDALPVITRPQAALADGAPAIHPGGNLLRHSEIDAGEPEVRISTADLQLEGH
YETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTVAQALGLPWSHVRVIKPYV
GGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVATRTRHAFSIDARLGMRRDGQ
LEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFGYCADTVYTNLPAAGAMRGYG
APQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNPVNGKTIYSAGLTECLEKGRRL
FEWDQRRAECLAQAADAPVRRGIGIACFSYGSNTYPVGVEIAGARLLLNQDGTVNLQIGA
TEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDITAFDPGAFASRQSYVAAPAIRRAA
EIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPDQVLMSVADVAMQAYYHQEIGAQIL
AEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRILNLHDSGRILNPQLAEGQVHGGMGM
GIGWALFEEMIIDEQSGVVRNPNLLDYKFPTCVDLPDLECAFVETVEPQSAYGHKALGEP
PIISPGPAIRNAIRMATGVAINALPITPKTLYREFVQAGLIRE
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgtctttaggatcgccgctgcggcgggttgatgccgaagccaaggtcaccggacaggcg
cgttataccgatgatatgatgatgcccggcatgctccatgcctgctacgtgcgcagccgt
atcgcccacggtaacgtcaccgccatcgatacccgggaagcggagtccatgcccggcgta
gaagccgtcttcacctttcacgatgtcccctcagcccccttccctactgccggccacgcc
tggtctctggagccgggcaaacgggatatcgccgatcgccatctgctgaccggccacgtg
cgccactttggcgacggcgtcgccatcgtcgtcgcccgcgatctgctcagcgccgagcgc
gccgcggcgcgggtacaggtcagctatgatgcgttgccggtgatcacccggccacaggca
gccctggctgacggtgcgccagctattcaccccggcggcaatttgctgcgccacagcgag
atcgacgccggagagccagaagtccgcatctccaccgccgatctgcagctggagggtcac
tacgagacgccggtggtgcagcactgccacatggagggcgtgacctgctatgcctatatg
gagcagcccgatcacatcgtcattgtctccagcacccaaattccccagattgtccggcgc
accgtcgcccaggccctcggtctcccctggtcgcacgtccgggtgatcaagccctacgtc
ggcggcggattcggtaataagcaggatgtgctggaagagccgatggccgcctttttaacc
cagcgcctcggcggtaaaccggtcaaggtcagcctgagccgggaggagtgcttcgtcgcc
acccgcacccgccacgccttcagcatcgatgcccggctaggtatgcgccgggatggccag
ctggaggggtaccggctgacggtgctgtccaacaccggcgcctatgcctctcacggccac
tcgattgccgctgccggcgccaataaaatcagctatctctatccccgcagcgcctttggc
tactgcgctgatacggtgtataccaacctgcccgccgccggtgcgatgcgcggctacggc
gcaccgcaggtcgactttgccctggaatgcctgatggacgacgccgcggcccgcctcgat
ctcgatcccctcgaggttcgtctgcgcaacgtcgcgcgtcagggcgaccgcaacccggtt
aacggaaagaccatctacagcgccgggctcacagagtgcctggaaaaaggccgccgtctg
tttgagtgggatcagcgccgcgccgaatgtctggcccaggcggccgatgcgccggtgcgg
cgcggcatcggcatcgcctgtttcagctatggttccaatacctatccggtcggggtggag
atcgccggcgcccgcctgctgctcaatcaggacgggacggtaaacctgcagattggcgcc
accgaaattggccaggggtccgataccgtcttcgcccagatggcatcggaaacgctgggg
atcccctttaaacagatccgggtgatctcaactcaggataccgatatcaccgccttcgat
cccggcgcctttgcctcacggcaaagctacgtcgccgccccggcgatccgccgagcagcg
gagatcatgcgccagaagatcctggcgcacgcggcgctgataagccaccagccggagtgg
ggactgaccctgtgcgacggtaacgtggtgatggcgatgcagccggatcaggtgctgatg
agcgtcgccgacgtcgccatgcaggcctactaccaccaggagatcggcgcacagatcctg
gccgaggtctcccataaaaccaccaccaatcccccggctttcggctgcacctttgtcgat
ctcagcatcgacatcgcgctatgccaggtcactattaaccgcatcctgaatctgcatgac
tccgggcggatcctcaacccgcagctggcggagggacaggttcacggcggcatgggtatg
gggatcggctgggcgctgttcgaagagatgatcatcgatgagcagagtggcgtggtacgc
aatccgaatctgctcgactacaaattccccacctgtgtcgacctgccggatctggagtgc
gcctttgtcgagacggtggagccgcagtcagcctatggccacaaggcgctgggagagccg
ccgatcatttcgcctggaccggcgatccgcaacgccattcgcatggcaacgggggtcgcg
atcaatgcgctgccgatcacccccaaaacgctgtatcgcgaatttgtgcaggccggactg
atcagggagtaa

DBGET integrated database retrieval system