KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00444
Entry
ECL_00444         CDS       T01231                                 

Definition
(RefSeq) putative plasmid-like protein
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_10 AAA_22 AAA_7
Other DBs
NCBI-GeneID: 9122953
NCBI-ProteinID: YP_003610959
UniProt: A0A0H3CFI4
Position
455117..457915
AA seq 932 aa
MAFSLFRRRAEAQEAHQYGDGPFSVNGHEPLTREGRLTRSEEAKLYETAPSIIDHIPWGE
YLPEHQCILLDDGVSVGAVYEIIPVGTEGRPDSRLEEIRDVVENALQDSLPELDTHQWVV
QFYCQDESDLMVYMDKIRGYVKPRAQGTDFTDAWLREQARHLQNVATEKGLFVDEAVTGA
PWRGQIRRTRMVIYRWVESPYRDPMAPEVLLKQVCDRLTAAMSGAGIQCQRQNGEQIHSW
LLRWFNPEPTWVDKATLYRCARHTDDAPGELPLLNDFSESLWFTRPRSDAEKGVWWFDDV
AHRAVPVARLRSAPTTGHLTGEVRRGDNINAIMDLLPEGTVLVMTLVIHPQDKLEENFAR
LSRDSMGENVDSLRAREDAATARTYLGNKHKLYRAAITLLIKARDLPSLDSRYLDLSSKL
LNCGLEPVNPEHDIGPLSTYMRALPMCFNPEQDRHNWYTRLMFVQHFACLAPVYGRDTGT
GNPGFTFFNRGGGPLSVDPLNKNDRTQNAHLLLFGPTGAGKSATALDKLAQMIAIYRSRI
FLLEAGNSFGLAGDYFESLGLTVHRVSIKPGKAISLAPFGDSHLLMQEKPDELIISEDAL
PDIDDDEDKDEKRDVLGEMEIAARLMITGGEPAEEQRMTRADRGMIREAIMIAARSTFEA
GRQMLPEDLMFALQGIARDAGMGEDGRERRTAARRARAEEMSEALRMFTEGFEGELFNRP
GTPWPEADVTIVDLGTLAREGYEAQMAVAVISLLNTINNIAEREQYSDRDIIVSIDEAHI
VTANPLMGPYATKIVKMWRKLGAWLWLFTQNLADFPDTAKKMLNMAEWWICLVMPPDEVE
QIARFKTLNSEQKAMLLSATKLPKKYTEGVILSRKVQALFRAVPPSLYLALGMTEKEEKA
ERRLIMNELQCSELEAAFHVARRLDENRGLSI
NT seq 2799 nt   +upstreamnt  +downstreamnt
atggccttttcacttttccgtcgcagggctgaagcgcaggaagcacaccagtacggtgac
gggccgttttctgttaacggccatgaacccctgacgcgcgagggacgtctgacccgcagc
gaggaagcgaagctgtatgagacggctccgtccatcatcgatcacattccctggggggaa
tatctccctgaacatcagtgcatcctgcttgatgacggcgtgtcggtcggggcagtttac
gaaatcatcccggtgggcaccgaggggcgtccggattcccgcctggaggaaattcgcgac
gtggtcgaaaacgccctgcaggacagtcttccggagctggatacacatcagtgggtggtg
cagttctactgtcaggacgagtctgacctgatggtgtatatggataagatccgggggtat
gttaagccccgggcgcagggcaccgacttcaccgacgcctggctgagggaacaggcccgt
catctgcagaatgtggccactgaaaaaggcctgtttgtcgatgaggccgtcaccggtgcg
ccgtggcgcggtcagatacgtcgtacgcgtatggtcatctaccgctgggtggagtcaccg
tatcgtgacccgatggcccccgaggtgctgctgaagcaggtctgcgatcgcctgacggcc
gccatgagcggtgccggtattcagtgccagcgccagaacggcgagcagatccacagctgg
ctgctgcgctggttcaaccctgaaccaacgtgggtggataaggccacactgtatcgctgt
gccagacatactgacgacgctcctggcgaactgccgttgctgaatgatttcagtgaaagc
ctgtggttcacccgcccccgcagtgatgcggagaaaggcgtatggtggtttgatgacgtg
gcgcacagggcggtgccggtggctcgtctgcgcagcgcacccaccacggggcacctgacc
ggcgaggtccgccgtggcgataatatcaacgccattatggacctgctgccggaaggtacg
gtgcttgtcatgacgctggttatccatccgcaggacaagctggaggaaaactttgcccgg
ctgagtcgtgactcgatgggggagaacgtggattcgctgcgtgcccgggaggatgcggcc
accgcccgcacttacctgggtaataagcataaactgtatcgcgcggccattaccctgctg
attaaagcccgcgacctgccttcactggacagtcgctatctcgacctcagcagtaagcta
ctgaactgcgggctggagccggtaaacccggagcatgatatcgggccgctcagcacctac
atgcgtgcattacccatgtgctttaatccggagcaggaccggcacaactggtatacccgt
ctgatgttcgtgcagcattttgcctgcctggcgccggtgtacgggcgtgataccggcacc
ggcaacccgggctttaccttttttaaccggggcggtggtccgctgtccgtcgatcccctc
aacaaaaatgaccgtacgcagaacgcccacctcctgctgtttgggccgaccggtgcaggt
aaatcggctaccgcacttgataagctggcacaaatgatagccatttaccgttcacgtatc
tttttactggaggcgggtaacagcttcgggctggccggagactactttgagtccctggga
ctcaccgttcatcgtgtcagcatcaagcccggtaaggccatctcgctggcgccgttcggt
gattcgcatctgctgatgcaggaaaaaccggatgaactcattatcagtgaagacgccctg
ccggatattgatgacgatgaggacaaggatgaaaaacgtgatgtgctgggtgagatggag
attgcagcacgcctgatgattaccggcggcgagccagcggaggagcagagaatgacgcgc
gccgatcgcgggatgatccgggaagccatcatgatcgctgcgcggagtacgtttgaggcc
ggacggcagatgttgcctgaagatctgatgtttgcgctgcagggcatcgcccgggatgcc
gggatgggtgaggacgggcgcgaaaggcgtacggccgcgcgccgggcccgtgctgaggaa
atgtcggaagcgctacggatgtttaccgaaggctttgaaggtgagctgtttaaccgtccg
ggtacgccgtggccggaggctgatgtgaccatcgttgaccttggtacgctggcgcgcgaa
ggctatgaggcgcagatggccgttgcggtgatttccctgctcaacaccatcaacaatatt
gctgagcgcgagcagtacagtgaccgggatattatcgtgtcgatcgatgaggcgcatatc
gtgaccgcaaatcccctgatggggccttatgccaccaagattgtgaaaatgtggcgtaag
ctgggtgcctggctctggctgttcacgcagaacctggccgactttccggatacggccaaa
aagatgctcaatatggcggagtggtggatttgtctggtgatgccccctgatgaagtggag
cagatagcgcgttttaaaacgctgaacagtgaacagaaggcgatgctgttgtctgccacc
aaacttcctaaaaaatatacggaaggcgttattttgtcacgtaaggtgcaggccctgttc
cgtgccgtgcccccgagcctctaccttgctctgggtatgacagaaaaagaagagaaagct
gaaagacgcctcattatgaatgaattacagtgcagtgaacttgaggctgcgtttcatgtt
gcgcgccggcttgatgaaaatcgcggactgagtatctga

DBGET integrated database retrieval system