KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3441
Entry
ECO103_3441       CDS       T01096                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00230  Purine metabolism
eoh01100  Metabolic pathways
eoh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECO103_3441 (xdhA)
Enzymes [BR:eoh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECO103_3441 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: BAI32178
Position
3507921..3510218
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITTPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVSCFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttatgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
agaagtttgccgggcgtactggcgatttttacctgggaagatgtgcctgatattccattt
gctactgctgggcatgcctggacacttgacgaaaacaagcgcgataccgccgatcgcgca
ctgctaactcgccatgttcgtcatcatggtgacgccgttgccatcgtcgtggcccgcgat
gaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaagaattacccgtt
atcaccacgccagaagcggcgctggcagaagacgctgcaccaatccataacggtggcaat
ttactgaaacaaagcacgatgtcgacgggtaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagacccccgttattcaacattgtcacatggaaagcgta
acatcgctggcgtggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccgtttgtcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcggcattcctgaccagcaagcttggcggcattccggtgaaagtttcccttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttaccattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccatcgcttctgcgggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgac
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggcaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagaatgccagaaccagcaa
ggcaatttgcgccgcggcgttggcgtctcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgccttctgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggtcagggtgccgacaccgtcttctcgcaaatggtggca
gaaaccgtgggggttccggtcagcgacgttcgcgttatttcaactcaagataccgacgtt
acgccgttcgatcccggcgcatttgcctcacgccagagctatgttgccgcgcctgcgctg
cgcagtgcggcactattattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatctgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgctgaaagctccatcaaaaccaccactaacccaccggcgtttggctgt
acctttgttgatctgacggtcgatattgcgctgtgcaaagtcaccatcaaccgcatcctc
aacgttcatgattcagggcatattcttaatccactgctggcagaaggtcaggtacacggc
ggaatgggaatgggcattggctgggcgctatttgaagagatgatcatcgatgctaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccaccaataattcctgttgccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctgacgccaaaacggttatatgaagagttccat
ctggcaggattgatttga

DBGET integrated database retrieval system