KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum0270
Entry
Erum0270          CDS       T00224                                 
Symbol
virB11
Name
(GenBank) type IV secretion system protein VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eru00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Erum0270 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eru02044]
    Erum0270 (virB11)
Enzymes [BR:eru01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Erum0270 (virB11)
Secretion system [BR:eru02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Erum0270 (virB11)
SSDB
Motif
Pfam: T2SSE AAA_7 AAA_28 AAA_19 AAA_16 IstB_IS21 MoCF_biosynth
Other DBs
NCBI-ProteinID: CAH57734
Position
complement(33611..34609)
AA seq 332 aa
MTTSYAALNTYLEPLQAIFQEEGVNEISINQECEVWIENRGNIRCESIPVLNLSHLKALG
RLIAQATEQKISEENPLLSATLPNGYRIQIVFPPACEATAVAMSIRKPSAMQLSLDDYEK
MGAFDQAITENQQNTVDIELNKLLKQKKIKDFLEYAILHKKNIIISGGTSTGKTTFTNAA
LRTIPKDERLITVEDAREIVLNNHPNRVHLITSKGGQGRAKVSIQDLIEACLRLRPDRII
VGELRGAEAFSFLRAINTGHPGSISTLHADTPMMALEQLKLMVMQAGLGIPPDQIINYIT
NIVDIVIQLKRGSSGVRYVSEILFTKSLQKND
NT seq 999 nt   +upstreamnt  +downstreamnt
atgacaacaagttatgcagctttaaatacatatcttgaaccattacaggctatctttcag
gaagaaggagtaaatgaaatatctataaaccaagagtgtgaggtgtggatagaaaatcga
ggaaatatacgttgtgaatctataccagttctcaatctatcacacctaaaagcattagga
agattaattgcccaggctacagaacaaaaaataagtgaggaaaatcccctattatcagca
acattacctaatggctatcgtatacagatagtttttcctccagcatgtgaagcaactgca
gttgctatgtcaataaggaaaccatcagctatgcagctttccttagatgactatgaaaaa
atgggagcatttgaccaagccataacagaaaatcaacagaataccgtagatattgaactc
aataaattattaaaacaaaaaaaaatcaaagactttttagagtatgcaatattacataag
aaaaacataataataagtggtggtacatcaacgggaaaaacaacttttactaatgcggca
ttacgtaccataccaaaggatgaaaggttaattacagtagaggatgcaagagaaattgtt
ttaaataatcatccaaatcgagtacatcttataacatccaaaggagggcaaggtagagct
aaagtaagtattcaagatctaatagaagcatgcttaaggttacgtccagatagaataata
gttggagagctacgtggagcagaagcttttagtttcctaagagcaattaatacaggacac
cctggatcaatatctactctacatgctgatacaccaatgatggctcttgaacaattaaaa
cttatggttatgcaagcaggtcttggtattcctcctgatcaaattatcaattatataacc
aatatagttgatattgtaatacaattaaaacgtggatcatctggtgtaagatatgtatca
gaaatactgttcactaaatctttacagaaaaatgattaa

DBGET integrated database retrieval system