KEGG   Fusarium pseudograminearum: FPSE_09019
Entry
FPSE_09019        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00910  Nitrogen metabolism
fpu01100  Metabolic pathways
Module
fpu_M00531  Assimilatory nitrate reduction, nitrate => ammonia
fpu_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    FPSE_09019
Enzymes [BR:fpu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     FPSE_09019
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske Rieske_2 NIR_SIR_ferr Rubredoxin_C K_oxygenase NAD_binding_7 FAD_binding_2
Other DBs
NCBI-GeneID: 20367636
NCBI-ProteinID: XP_009260411
UniProt: K3VAT2
Position
2
AA seq 1088 aa
MTATTQKRIVVVGLGMVGIAFIEKLLKYDAKSKEYTITVVGEEPYLAYNRVGLTTFFEHR
KVEELYMNPSEWYLESEASLNYHINTKATHIDTDNKFIECANGESYPYDILVLATGSDAI
LPRMLKGWDSNGVFVYRTIDDLNKLIKFSGDKQGTNGVVVGGGLLGLEAAKAMLDLECYN
KIDLIERSPWVLSRQVDETAGKMVADQVQQLGVNINLGKGVSSLKTDENNNLTGVVFDDD
SEVNCSTLCFAIGVKPRDDLARAANLEIGQRGGIVVNDDLRTSMPDIYAIGECASWRGMA
YGLIGPGVAMAEVVAFNLTQAKLHSPQTFKTPDMSTKLKLLGVNVASFGDCFADRDGPIT
LPRKYAKNLVNGDAKSPNSVQALTYRDPFSNVYKKYIFTKDGKYLLGGMMIGDVCDYVKL
LPMVKSQKELDVSPSELILGAKKGDEDSDDLDDDAQVCSCHNVTKGDIVKVIKDGTCKDI
ASIKKCTKAGTGCGGCVPLVTTIFNKTMASMGQEVTNYLCSHFSYSRADLFNIVMVKRLK
SMNEVMREVGNDKNAVGCELCKPAVASIMASLWNRHVMDKTTHGLQDTNDRFLGNIQRDG
TYSVVPRVSGGEITPDKLVVIGEVAQKYNLYTKITGGQRIDLFGAQKQDLLDIWGQLVAG
GMESGHAYAKSLRTVKSCVGSTWCRFGLSDSVGLAVRLEERYKSIRAPHKIKGGVSGCVR
ECAEAQSKDFGLIATEKGWNIFVGGNGGANPRHAELLAKDVPPADVVTILDRYLMFYMRT
ADKLQRTARWIENLPGGIKYLQEVILEDKLGINASLEAQMEELVDSFFDEWAEAIKTPAI
ANKFKQFANTSDTTRNMELEDDRGQKRPAFWPNDAAAKDDFQGLKDKWSMTAWEPIIESS
YFDGADELPNGISATIKRGDTQLAIWRIKGVYYATQQMCPHKRAFILSDGLIGQEGHKAE
QNGDKAGAAPWVSCPHHKRNFDLENGACKTDESMSIATFLTEARSDGMLYLKLPPVDELD
SALGTKKWMVKKGEAGEAPLAKLDSKIKFVGIRGKKPYVKPTGQSKMTTKPMDLMMASNG
CGGGAPEW
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgactgcaacgacacaaaaacgcattgtcgtcgttggactgggcatggtgggcattgcc
tttatagaaaagctgctcaaatatgatgccaaatcaaaagaatacacaataacagtggtc
ggagaggaaccatatcttgcctacaatcgagtaggactcacaactttcttcgagcaccgc
aaagtcgaggagttatacatgaacccatcagaatggtacctagaatctgaagcttcatta
aattaccacatcaatacaaaagccacacatatcgacactgataacaagtttatcgaatgt
gcaaatggcgagagttatccatacgacatccttgtcctcgctacaggctcagatgctatc
ctccctcgcatgttgaaaggatgggatagcaacggagtctttgtataccgtacgatcgat
gacttgaacaagcttatcaagttctctggagacaaacagggcaccaatggagttgtcgtg
ggcggtggtctgctcggtctggaagccgccaaggctatgctggatctcgaatgctacaac
aaaatcgatcttattgagaggtccccctgggttttgagcagacaggtcgacgaaacagcc
ggtaagatggtggcagatcaggttcaacaacttggtgtgaacatcaacttgggtaagggt
gtgtccagcttgaagacggacgagaacaacaacctcactggagtcgtctttgatgatgac
tcggaggtcaattgctctacactgtgctttgctattggtgtcaagcctagggatgacctc
gcaagggcagctaacctcgagattggccaacgaggcggtattgttgtcaacgacgacttg
aggacaagcatgccagacatctacgccattggagaatgtgctagctggaggggcatggca
tacggtctcatcggtcctggagttgcaatggctgaagttgttgccttcaaccttacccaa
gccaaactccacagccctcaaaccttcaagactcctgatatgagcaccaagctcaaacta
ttgggagtcaacgtcgcaagtttcggtgactgtttcgctgaccgcgatggtcccattacc
cttcctcgcaaatacgcaaagaacctggtcaatggcgacgccaagtctcccaattctgtt
caggcgctcacatacagagatcccttttccaacgtctacaagaaatacattttcaccaag
gatggaaagtatctccttggtggtatgatgattggcgatgtttgcgactatgtcaagctt
ctgcctatggtcaagtctcaaaaggaacttgatgtgtctcccagcgagctgatcctcggc
gctaagaagggagatgaggactcggatgatcttgacgatgatgcccaagtgtgctcatgc
cacaatgtcaccaaaggcgatatcgtcaaggttatcaaagacggcacatgtaaggatatc
gccagcattaagaagtgcacaaaggctggtaccggttgtggtggctgcgtgcccctcgtc
actaccatcttcaacaagacgatggcttcgatgggccaagaagtcacaaactatctttgc
tcgcacttcagctactcacgtgctgacttgttcaacattgttatggtcaagcgcctcaag
tctatgaacgaggtcatgcgcgaggtcggaaatgacaaaaacgctgttggttgtgagctg
tgcaagcctgcagtggccagcatcatggcttcactgtggaacagacacgttatggacaag
acgacccacggtcttcaggacacaaatgatcgtttcctgggtaacatccagcgtgatgga
acctactctgtggtgcctcgtgtatccggtggtgaaatcacccccgacaagcttgtcgtc
attggcgaggttgctcagaagtataacctgtacaccaaaatcacgggtggacagcgtatc
gacttgtttggtgcccagaagcaggatctgttggacatctggggtcagcttgtcgctggc
ggtatggaatctggccacgcatatgctaagtcactgcgaaccgtcaagagttgtgtaggt
tctacatggtgtcgattcggcctcagtgatagtgttggtctggctgtacgtctggaggag
aggtacaagagtatccgagcccctcacaagatcaaaggtggtgtcagtggctgtgtgcgc
gaatgtgctgaagctcaaagcaaagactttggtttgatcgctacagaaaagggctggaac
atcttcgttggtggtaacggtggtgcaaacccccgccatgccgagctattggccaaggat
gtgcctccagctgatgttgtcactattctggaccgctatctcatgttctacatgcgcaca
gccgacaagctccagcgaacagcacgctggatcgagaacctccccggaggcatcaagtac
ctccaggaggtcatccttgaggacaagcttggcatcaatgcctcgcttgaggctcagatg
gaagaactcgttgacagtttcttcgacgagtgggccgaagccatcaagactcctgctatt
gcgaacaagttcaagcaatttgccaacacaagtgatacgacgcgcaacatggaacttgag
gatgaccgtggtcaaaagcgacctgccttctggcctaatgatgctgcggcaaaggatgat
ttccagggcctcaaggataagtggtcaatgacggcttgggagcccatcattgaatcatca
tactttgacggtgctgatgagctgcccaatggcatctctgctacaatcaagcgtggcgac
actcaacttgccatctggcgtatcaagggtgtctactacgctactcaacaaatgtgccct
cacaagcgtgccttcatcctatcggacggtctcatcggtcaagaaggtcacaaggccgag
caaaatggcgacaaggcaggcgctgcgccctgggtctcatgtcctcaccacaagcgcaac
ttcgaccttgaaaatggtgcttgcaaaacggatgagtccatgtccatcgctacattcctc
accgaggctcgctccgatggtatgctgtacctcaaacttccccctgtggacgagctcgac
agcgccctaggcaccaagaagtggatggtgaagaagggcgaggcgggtgaggcaccgctg
gccaagctcgatagtaagatcaagtttgtgggtattcgtggtaagaagccatatgtcaag
cctactggtcagtctaagatgactaccaagccgatggatctcatgatggcttccaatgga
tgtggaggtggtgcaccggagtggtaa

DBGET integrated database retrieval system