KEGG   Gallus gallus (chicken): 100857897Help
Entry
100857897         CDS       T01006                                 

Gene name
PDIA2
Definition
(RefSeq) protein disulfide-isomerase A2
  KO
K09581  protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100857897 (PDIA2)
Chaperones and folding catalysts [BR:gga03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100857897 (PDIA2)
Membrane trafficking [BR:gga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100857897 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 OST3_OST6 Thioredoxin_2 Thioredoxin_8 AhpC-TSA ERp29_N Redoxin Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100857897
NCBI-ProteinID: XP_015150100
CGNC: 65167
Position
14
AA seq 539 aa AA seqDB search
MRGGAVLCGLLLSLAWLGPAWGAEGGEEDGEVVVAEEEEEDEEDEVLSDELEEEDGVLVL
HEHNFERALREHRLLLVEFYAPWCGHCRRLAPEFARAAALLRNGSESARLGKVDAVAQTA
LSAEFHIEAFPTLKLFRDGNRTHPVAYSGRMDAEGMALWVQRRAGPSATLLHDADTAAAF
VSARDIAAVGFFKDLRGEAARAFYEVAAEVVDVAFGVAEADELFEAYGLSADTVCLFKKF
DEGRTDFPVDPEQGLDVAKLTRLLRVHSLQLVMDFSNETSSQIFGAKIPHHMLLFLNTSV
AEQQALRDEFRVAAGTFRGEVLFVVVDVDGYGATVLPFFGLKPSDAPTLRFIKMENNRKY
RMEEDAFSATAVRDFVRAVLDGKVKPQLLSAEPPEDWDTRPVKVLVGKTFEQVAFDETKN
VFVKFYAPWCTHCQEMAAAWEELGERYKDHEDIVIAEMDATANELENITISGYPTLHYFP
AGPGRKMVEYRSARDVETFSKFLENGGKLPEEPPTVSKAPENSTESPSPSGAAEAREEL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcggcgcggtgctgtgcgggctgctgctgtcgctggcctggctgggcccggcg
tggggggccgaggggggggaggaggacggggaggtggtggtggctgaggaggaggaggag
gatgaagaggatgaggtgctctcagatgagctggaggaggaggacggcgtcctggtgctc
cacgagcacaacttcgagcgcgccctgcgcgagcaccggctgctgctggtggagttctac
gctccgtggtgcgggcactgccgccgcctggcccccgagttcgcccgtgcggccgcgttg
ctgaggaacggatcggagtcagcacggctgggcaaggtggacgccgtggcgcagacggcc
ctgagcgccgagttccacatcgaggccttccccacgctcaaactcttccgcgacggcaat
cgcacccaccctgtggcgtacagcggccgcatggacgccgagggcatggcgctctgggtg
cagcgccgggccgggcccagcgccacgttgctgcacgacgccgacaccgccgccgccttc
gtcagcgcgcgggacatcgccgccgtgggcttcttcaaggacctgcgcggggaggcagcg
cgggcgttctacgaggtggccgcggaggtggtggatgtggcgttcggggtggccgaggcg
gatgagctgttcgaggcgtatgggctgtcggccgacaccgtctgcctcttcaagaagttc
gatgaggggcggacggacttccccgtggacccggagcagggcctggacgtggccaagctg
acgcggctgctccgcgtgcacagcctgcagttggtgatggacttctccaatgagacctcc
agccagatcttcggggccaagatcccccaccacatgctgctcttcctcaacacctccgta
gcagagcagcaggcgctgcgggatgagttccgtgtggctgctggcaccttccgcggcgag
gtgctcttcgtggtggtggatgtggatgggtacggtgccaccgttctgcccttcttcggc
ctgaagcccagcgatgcgcccacactgcgcttcatcaagatggagaacaaccgtaagtac
cgcatggaggaggacgccttctcagccacggccgtacgcgacttcgtgcgggcagtgctg
gacggcaaggtgaagccccagctgctgagcgcagagccccccgaggactgggacacgcgg
cccgttaaagtgctcgtggggaagacctttgagcaggtggcgttcgatgagaccaagaac
gtcttcgtgaagttctatgcgccatggtgcacccactgccaggagatggcggctgcctgg
gaggagctgggcgagcgctacaaggaccacgaggacatcgtcattgctgagatggacgcc
acggccaacgagctggagaacatcaccatcagcggatacccaacactgcactacttccct
gctgggccgggcaggaagatggttgaatataggagcgcccgagacgtggagaccttctcc
aagttcctggaaaatggagggaagctgccggaggagccacctacggtgtccaaggccccg
gagaacagcacagagtcaccgagcccatccggtgcagctgaagcacgggaggagctgtga

DBGET integrated database retrieval system