KEGG   Gallus gallus (chicken): 100858709
Entry
100858709         CDS       T01006                                 

Gene name
PRDM14
Definition
(RefSeq) PR domain zinc finger protein 14
  KO
K24646  PR domain zinc finger protein 14 [EC:2.1.1.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    100858709 (PRDM14)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     100858709 (PRDM14)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    100858709 (PRDM14)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 SET zinc_ribbon_15 zf-C2HC_2 Zn-ribbon_8 zf-C2H2_11 PyrI_C zf-met C1_1
Other DBs
NCBI-GeneID: 100858709
NCBI-ProteinID: XP_025003759
CGNC: 64389
Position
2
AA seq 516 aa
MALALAGEPGPATDATDALGLSPAGLAAYYPPFLPPAQYLEAPPDFFQPLGRLLPPSPPL
PPFGIPAFLSLPPPPSAPPPLAQAPADAPQRAARPGGGCETAGQSRRFHFSEEELNAVLY
GALRSPQLPGGLHAISGLRVPPASPGAARSPPAPPPDGDALQLPEGLAVLRVAYGDVWHL
GVFCTAPIPKGVRFGPFQGKVVNTTEIKTYDDNSLMWEVFEYGQLSHFIDGKGTAGNWMS
LVNCARFPEEQNLTALQCQGQIFYESCREIAPKEELLVWYGDCYVQFLGIPICLKGMPEA
GRPPQHPEGENAASFKCERCGKVFAYRYYRDKHLKYTRCVDRGDRKFPCHLCSRSFEKRD
RLRIHVLHVHEKHRPHKCSVCGKSFSQSSSLNKHMRVHSGERPYKCVYCNKAFTASSILR
THIRQHSGEKPFKCKHCGKAFASHAAHDSHMRRTHSKDKGSTCAVCGQHFPELEDYRFHM
NVHAAAHSQESLSWTSSVGVSVYVCVCWLCACRRKH
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggcgctggccctggccggcgagccgggccccgccacggacgccacggacgcgctcggg
ctgagccccgccgggctcgccgcctactacccgcccttcctgcccccggcgcagtacttg
gaggcgccccccgacttcttccagcccctgggccgcctgctgcccccctccccgccgctg
ccccccttcggcatccccgcgttcctcagcctcccgccgcccccctcggccccgccgccg
ctcgcccaggctccggcggacgccccgcagcgggcggcccggcccgggggaggctgcgag
acggcggggcagagccgcaggttccacttcagtgaggaggagctgaacgcggtgctgtac
ggggcgcttcgtagccctcagctgcccggcgggctgcacgccatctcggggctccgcgtg
ccccccgccagcccgggtgccgctcgctccccaccggctccgccgcccgacggggacgcg
ctgcagctgcccgaagggctggccgtgctgcgcgtggcctacggggacgtttggcacctc
ggggtgttctgcaccgcccccatccccaaaggagtccgcttcggcccgttccaaggcaaa
gtggtcaacaccaccgagatcaagacttacgacgacaactcgctgatgtgggaggtcttc
gaatacgggcagctgagccacttcatcgacgggaagggcacagccggcaactggatgtct
ctggtgaactgcgcccgcttccccgaggagcagaacctgacggcgctgcagtgccagggg
cagatcttttacgagagctgccgggagatcgcgcccaaggaggagctgctggtgtggtac
ggggactgctacgtgcagttcctgggcatccccatctgcctgaagggcatgccggaggcg
gggcggcccccgcagcaccccgaaggtgagaacgcggcgagcttcaagtgcgagcgctgc
gggaaggtgttcgcctaccgctactaccgcgacaaacacctcaagtacacgcgctgcgtg
gaccggggcgacaggaaattcccctgccacctctgcagccgctccttcgagaagagggac
cggctgcgcatccacgtgctgcacgtccacgagaagcacagaccccacaagtgctcggtg
tgcgggaagagcttctcgcagtcctccagcctgaacaaacacatgcgggttcactccggg
gagcgcccctacaaatgcgtctactgcaataaggcgttcacagcctccagcatcctgcgc
acgcacatccgccagcactcgggagagaagcccttcaagtgcaagcactgcggcaaagcc
ttcgcctcgcacgcggcacacgacagccacatgcggcgcacgcacagcaaggacaagggc
agcacctgtgcagtgtgtggccagcactttccagagctggaggactaccgcttccacatg
aacgtccacgctgctgctcatagccaggagtccctctcctggaccagctctgtgggtgta
tctgtgtacgtgtgtgtatgttggttgtgtgcatgccgcaggaagcattga

DBGET integrated database retrieval system