KEGG   Gallus gallus (chicken): 395836
Entry
395836            CDS       T01006                                 

Symbol
MERTK
Name
(RefSeq) tyrosine-protein kinase Mer precursor
  KO
K05117  c-mer proto-oncogene tyrosine kinase [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    395836 (MERTK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     395836 (MERTK)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  AXL family
   395836 (MERTK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 Ig_2 fn3 I-set ig APH Pkinase_fungal
Other DBs
NCBI-GeneID: 395836
NCBI-ProteinID: NP_990319
CGNC: 6255
Ensembl: ENSGALG00000008257
UniProt: Q90777
Position
3
AA seq 974 aa
MGGGRCALLCALLCALPLPRCGAAEFGGAGGHGGLRSLSAGAPLARPLWAKHHRPKRGLT
SGRWPPQGAKPSATSVGQLKFNPTVGHVVINELKDVTFNCSIKVPQLLVRPDSPGISLWK
DGRELHTLDRIATSHFEILDEEEVAMTSTFSIRAAQRSDNGSYVCKLNISGIEIASDPIL
VQLEGLPHFIQQPEKLNVTRNSPFNLTCQAVGPPEPVEIYWFRNNVQLNMKPYISPSVLT
VPGLNETALFSCEAHNSKGLTASNPGQVNVKGIPSAPKAVHVLKRMAHSIVISWVPGFDA
FSALNSCSVQVKEAVPQSNVSLLLFNTSVPPHVYRIQQLWPMADYNISVSCKNEVGWSAF
SPWITASTTEGAPTTQPLNVTVSLNESSSFLEIRWVKPPLERTHGELQGYHIWHTWQDSK
GLQNISLEAQPNATVAILPVVATNATCSVRVAAVTKGGVGPFSSPVEVFVPASGLITSSP
SSTPASGNTDSFIVALGFVCGTVAVGLILCLSVVIQKRCMETKYGNAFSRNDSELVVNYT
AKKSYCRRAVELTLGSLGVSSELQQKLQDVVIDRNALSLGKVLGEGEFGSVMEGRLSQPE
GTPQKVAVKTMKLDNFSHREIEEFLSEAACMKDFDHPNVIKLLGVCIELSSQQIPKPMVV
LPFMKYGDLHSFLLRSRLEMAPQFVPLQMLLKFMVDIALGMEYLSSRQFLHRDLAARNCM
LRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTTKSDVWAFGVTM
WEIATRGMTPYPGVQNHEIYEYLFHGQRLKKPENCLDELYDIMSSCWRAEPADRPTFSQL
KVHLEKLLESLPAPRGSKDVIYVNTSLPEESPDSTQDLGLDSVIPQADSDLDPGDIAEPC
CSHTKAALVAVDIHDGGSRYVLESEGSPTEDAYVPLLPHEGSAWTEASTLPVGSSLAAQL
PCADGCLEDSEALL
NT seq 2925 nt   +upstreamnt  +downstreamnt
atgggcggcgggcgctgcgcgctgctctgcgcgttgctctgcgctctgcccctcccgcgc
tgcggggccgctgagtttggtggtgctggtggacatggaggcctgaggtccctatctgca
ggagccccgctggcaaggcccctgtgggcaaagcaccaccgccccaaacgaggcctcacc
agtggccgctggcctccccagggcgcaaagccttctgccacctccgtgggacagctgaaa
tttaaccccacagtgggacacgttgtgataaatgagctcaaagatgtcacatttaactgc
tccatcaaagtacctcagctgctagtccggccagactcccctggcatttccctgtggaag
gatggcagggagctgcacacgctggaccgcatcgccaccagccactttgagatccttgat
gaggaggaggtagccatgacctctacattcagcatccgtgctgctcagcgctcggataac
ggctcctacgtctgcaaactcaacatctctggcattgagattgcatctgatcccatcttg
gtacagctggaagggctcccacacttcattcaacagcctgagaagctgaatgtcaccagg
aacagccccttcaacctcacgtgccaagctgtgggcccaccagagcctgtggaaatctac
tggtttcgtaacaatgtccaactcaacatgaagccctacatctccccatcagttctgact
gtcccaggtctcaatgaaacagcactgttcagttgtgaggctcacaacagcaaagggctg
actgcttccaaccccgggcaggtcaacgtgaaaggaataccatctgcaccaaaagctgtg
catgtcctgaagagaatggcccacagcattgtgatctcctgggtgccaggcttcgatgcg
ttctctgccttgaacagctgcagtgtgcaggtcaaggaagccgttccacaaagcaatgtc
tcacttctgctctttaacacgtcggtgcctccccatgtgtatcgcatccagcagctgtgg
cccatggcagactataacatcagtgtttcctgcaagaatgaagtcggttggtcggcattt
agcccctggataacagccagtaccacggaaggagctccaactacccagccactgaatgtc
acagtgtcactcaacgaatccagctccttcctggaaatccgatgggtgaagccacccctt
gagaggacacacggggagctgcagggatatcatatctggcacacgtggcaggactccaag
gggctgcagaacatctccttggaagcccagcctaatgccacagtggccatcctgcctgtg
gtggccaccaatgccacgtgctcagtgcgtgtggctgctgtcaccaagggaggcgtgggg
cccttcagcagcccagtggaggtctttgttcctgccagtgggctaataacctcatctccc
tcttcgacaccagcatctgggaacacagactcctttatagtagcactgggcttcgtctgt
ggtacggttgctgttgggctgatcctctgcttgtctgtggtcatccagaaaagatgcatg
gaaacaaagtatgggaatgccttcagcagaaatgattcagagctggtggtaaactacaca
gccaagaagtcctactgccggagagccgtcgaactgacattgggtagcctgggagtcagc
agcgagctccagcagaagctgcaggacgttgtcattgacagaaatgccctcagcctgggg
aaggtcctgggagagggggagttcgggtcagtgatggagggacgtctcagccagccagaa
ggcaccccacagaaggtggctgtcaagaccatgaagttggataacttttcccatagagag
atagaagaattcctcagtgaagcagcatgcatgaaggactttgaccaccccaatgtcatc
aagctcctaggtgtgtgcatcgagctgagctctcagcagatccccaagcccatggtggtt
ctcccattcatgaaatatggtgacctgcacagcttcctgcttcgctcccggctggagatg
gccccccagttcgtgcccctgcagatgctgctgaagttcatggtggatattgccctggga
atggagtacctgagcagtcggcagtttcttcacagggatttggcggctcggaactgcatg
ttacgggatgacatgacggtgtgtgtggcagactttgggctgtccaagaagatctacagc
ggcgattactaccgtcagggccgaatagcaaaaatgccagtgaagtggattgcgatagag
tccctggctgaccgtgtctacaccaccaagagtgatgtgtgggcatttggcgttaccatg
tgggagatagcgaccagagggatgactccgtacccaggggtgcagaaccacgagatttat
gagtatctattccacgggcagcggctcaaaaagcctgagaactgcttagatgaactgtac
gatatcatgtcctcctgctggagggctgaacctgctgaccgaccgacgttctcacagctg
aaagttcatctggagaagcttttggaaagccttcctgccccgagggggtccaaggacgtc
atctacgtcaacaccagcctgccagaggagagccccgactccacccaggatttgggcttg
gattcggtcatcccccaagcggactctgacttggaccccggggacattgctgagccctgc
tgctcccacacgaaggcagcgctggtggcagtggatatccacgatgggggctcgaggtac
gtccttgaaagtgagggcagccccacagaggatgcttacgtcccactgctgccccacgag
ggctcggcgtggaccgaggccagcaccttgcctgttggcagctcgcttgcagctcagctg
ccatgtgctgatggctgcctggaggactccgaagcgctgctgtga

DBGET integrated database retrieval system