KEGG   Gallus gallus (chicken): 396047
Entry
396047            CDS       T01006                                 
Symbol
SNAI1
Name
(RefSeq) zinc finger protein SNAI1
  KO
K05707  snail 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    396047 (SNAI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    396047 (SNAI1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    396047 (SNAI1)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-C2HE zf-met zf-C2HC_2 zf-BED Zn-ribbon_8
Other DBs
NCBI-GeneID: 396047
NCBI-ProteinID: NP_990473
CGNC: 6068
Ensembl: ENSGALG00000008018
UniProt: O12939
Position
20:complement(13790862..13793593)
AA seq 256 aa
MPRSFLVKKHFSASKKPNYSELESQTVLAAPLLYETCALSVIPPPEVLGPGAYYPPLVWD
AGLLSSLFPAGLGTEAEAAGGAAPALDLTTLSSEEDEGKSSGPPSPASAPAAAERFRCAQ
CAKAYSTFAGLSKHKQLHCDAQTRKSFSCKYCEKEYVSLGALKMHIRSHTLPCVCKMCGK
AFSRPWLLQGHIRTHTGEKPFSCTHCNRAFADRSNLRAHLQTHSDVKKYQCKTCSRTFSR
MSLLHKHEETGCSGAR
NT seq 771 nt   +upstreamnt  +downstreamnt
atgccgcgctcgttcctggtgaagaagcacttctcggccagcaagaagcccaactacagc
gagctagagagccagaccgtgctggctgccccgctgctgtatgagacgtgtgcactgtcc
gtcatccctccacccgaagtgctgggccctggggcctattacccgccgctggtgtgggat
gctggtctgctctccagcctcttcccagctggcctgggcaccgaggcagaggcagcaggc
ggtgcggcaccagccctggacctgacaacactctctagtgaggaggatgagggcaagagc
tcggggccgcccagcccggcctcagcccctgctgctgctgagcggttccgctgtgcccag
tgcgccaaggcctactccacctttgctgggctctccaagcacaagcaattgcactgcgat
gctcagaccaggaaatccttcagctgcaagtactgcgagaaggagtatgtgagcctgggg
gctctcaagatgcacatccggagccacacgctgccctgtgtctgcaagatgtgcggcaag
gccttctcccggccctggttgctgcagggccacatccgaacgcacactggtgaaaagccc
ttttcctgtacacattgcaaccgggcctttgctgaccgttctaatctgcgcgcccacctg
cagacccattcagatgtaaagaagtaccagtgcaaaacctgctcccggactttctcccgt
atgtcgctgctgcacaagcacgaagagacgggctgctcaggggcacgctga

DBGET integrated database retrieval system