KEGG   Gallus gallus (chicken): 407779
Entry
407779            CDS       T01006                                 

Symbol
KRT5
Name
(RefSeq) keratin, type II cytoskeletal 5
  KO
K07605  type II keratin, basic
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    407779 (KRT5)
   04147 Exosome [BR:gga04147]
    407779 (KRT5)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     407779 (KRT5)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   407779 (KRT5)
  Exosomal proteins of other body fluids (saliva and urine)
   407779 (KRT5)
  Exosomal proteins of colorectal cancer cells
   407779 (KRT5)
  Exosomal proteins of bladder cancer cells
   407779 (KRT5)
SSDB
Motif
Pfam: Filament Keratin_2_head TPR_MLP1_2 AAA_13 CENP-F_leu_zip MukF_M ApoLp-III Baculo_PEP_C DOR Jnk-SapK_ap_N Taxilin DUF1451 ADIP DUF4407 ACCA
Other DBs
NCBI-GeneID: 407779
NCBI-ProteinID: NP_001001195
CGNC: 49888
Ensembl: ENSGALG00000032672
UniProt: Q6PVZ5
Position
33
AA seq 599 aa
MSRISYRSSTGGGMRGFSSGSAIVGGSGGGTRSSFSSVSVSRVGGGRAGGGGGFGAGGGF
GSRSLYNLGGSKRISLGGLRSGAGVGYGFGGGAGFGLGYGGGAGAALGLGGAGGGGGYGL
GGFGMGGPGFGGRGGPGFPVCPPGGIHEVTVNQSLLAPLKLDIDPEIQKVRTQEREQIKT
LNNKFASFIDKVRFLEQQNKVLETKWSLLQEQGHTVTRKSLEPLFETYINNLRRQLDSLM
GERGRLDSELRSMQDMVEDFKNKYEDEINRRTGAENEFVVLKKDVDGAYMNKVELQAKAD
GLADEINFLRALYEAELSQMQQQVSDTSVVLSMDNNRSLDLNSIIAEVKAQYEDIANRSR
AEAEAWYQNKYEELQVSAGRHGDDLRNTKMEISEINRMVQRLRNEIESVKKQCANLQAAI
AEAEERGEMALKDAKSKLAELEDALQKAKADLARQLREYQELMNVKLALDIEIATYRKLL
EGEESRLAGEGVGAVSVSVVSSSSGMGYGGGMGGGLSTGGGLCMGGGLSMGSGLGMGGGG
GSYTMSSSVGGGGFGGGSGSYSYGGGSNFSSSSSRGVSSSTGGSVRIVSKTTTSKKTIR
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgagccggatctcgtacagatcttccaccggagggggcatgaggggctttagctcaggc
tctgctatcgtgggaggcagcggtggtggcacgcggagcagcttcagctccgtctctgtc
tccagagttggaggaggaagagctggaggtggaggaggctttggagctggcggtggcttc
ggcagcagaagtctctataacctgggtggaagcaagagaatctccctcggagggctgcgg
agcggagccggcgtcggatacggctttggtggaggagccggctttggtctgggctatggt
ggaggagcaggagctgctttgggcttaggaggagctggtggcggtggtggctacgggctg
ggtggatttgggatgggaggtcccggatttggtggtcgtggtggccccgggttccccgtt
tgcccacccggtggcatccatgaagtgaccgtcaaccaaagcctgctggcacccctcaag
ctggacatcgaccctgagatccagaaggtgcggacacaggagcgggagcagatcaagacc
ctcaacaacaaatttgcctccttcatcgacaaggtgcggttcctggagcagcagaacaaa
gtgctggagaccaaatggagcctcctgcaagagcagggccacacggtcaccaggaagtct
ctggagcccctcttcgagacctacatcaacaacctgaggcggcagctggacagcctgatg
ggggagaggggacggctggactcggagctgcggagcatgcaggacatggtggaggacttc
aagaacaagtatgaggatgagatcaaccggcgcacgggcgcagagaacgagttcgtggtg
ctcaagaaggatgtggacggtgcttacatgaacaaagtggagctgcaggccaaagcagac
gggctggcagatgagatcaacttcctgagggctctctatgaagcggaattgtctcagatg
cagcagcaagtgtctgacacctccgtggtgctgtccatggacaacaaccgcagcctggac
ctcaacagcatcatcgcagaggtgaaggcacagtatgaggacatcgccaaccgcagccgg
gctgaggcagaggcttggtaccagaacaagtacgaagagctgcaggtctcagccgggcgc
catggggatgacctcaggaacaccaagatggagatctcagagatcaaccggatggtgcag
cggctgcgcaacgagattgagagcgtgaagaaacagtgtgccaacctccaagcagccatc
gctgaggcagaggagcgtggagagatggccctgaaagatgccaaatccaaactggccgag
ctggaggatgccctgcagaaagccaaggcagacctggcccgacaactacgcgagtaccag
gagctgatgaacgtcaagctggccctggacatcgagattgcaacctacaggaagctgctg
gagggcgaggagagcaggcttgccggagagggtgttggagccgtgagtgtctctgtagtg
agcagctccagcgggatgggctacggcggcggcatgggcggaggtctcagtacaggtgga
ggtctctgcatgggcggaggtctcagcatgggcagtggtcttggcatgggaggtggcggc
ggcagctacaccatgagcagcagcgtcggcggtggaggattcggaggtgggagtggaagc
tacagctatggtggaggcagcaacttcagctccagcagcagccgaggggtcagctccagc
acagggggcagcgtgcggatcgtttccaagaccaccaccagcaaaaagaccatcagataa

DBGET integrated database retrieval system