KEGG   Gallus gallus (chicken): 408035
Entry
408035            CDS       T01006                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor precursor
  KO
K04357  epidermal growth factor
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04020  Calcium signaling pathway
gga04068  FoxO signaling pathway
gga04510  Focal adhesion
gga04540  Gap junction
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    408035 (EGF)
   04012 ErbB signaling pathway
    408035 (EGF)
   04068 FoxO signaling pathway
    408035 (EGF)
   04020 Calcium signaling pathway
    408035 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    408035 (EGF)
   04540 Gap junction
    408035 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    408035 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    408035 (EGF)
Cytokines and growth factors [BR:gga04052]
 Growth factors
  Growth factors (RTK binding)
   408035 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b cEGF FXa_inhibition EGF_CA EGF DUF5050 EGF_3 SGL
Other DBs
NCBI-GeneID: 408035
NCBI-ProteinID: NP_001001292
CGNC: 9223
Ensembl: ENSGALG00000012155
UniProt: Q6PPB4
Position
4
AA seq 1245 aa
MFLFPVAFLPVIFTVDFASPSALQHWNCPNGYRLKSESSACVDIDECLEGGLGTCGQTCT
NVPGSYFCSCLPGYTLDIDKRSCYVNDPAPFLLFHHGSAIYRIDTEGTNHERLVDDAGPS
GLMDFHYTEEKVYWVDSEKRLLQRIHLNGTKRERLCYIDKGISGFAIDWINRDILWANRQ
KATIEATDMNGKKRRVLLRDIGRPTKIAIDAEQRILFWSSDGTVSSIYRMSLNGSDVRNI
LRTTEKIKAISLDFVDIRLYWIQHDHGKEISHIGSCDYEGSAVHLLRSSSRYQLLGMSLF
ADHLYYSELKSGTIWTANKYTGKAVVTISLKPSLFSLVEIKVVHPFKQPGARTDLQEFEK
GICDLNKEKCRRRICRPDSRTHRCKCSSGSILSRNKQFCEDINECGFWNHGCTLGCVNIP
GSYYCTCPRGFVLLPDRKTCHELISCLNNDTECSHGCLQTSKGPVCFCPEGSVLKEDGKA
CTGCTSPDNGGCSQICSSLSPFSWECACFPGYKLQRDRKHCTAIGPRPFLLFANGQDIRR
ISFDGTDYASLLDGQMGVVLALDSDPVENKIYFAHTALKWIERANLDGSNREKVIHGAID
IPEGLAVDWINRKLYWTDRGKACIERSTLNGMQRKMIIWEGISQPRGIAIHPFVRRLFWT
EMGIRPKIASSSLEGMDRRVIASMGLVHPSGIALDYLANKLYWCDAKQSVVESANLDGSG
RRILAQNDVGHPFAVAVFEDHLWLSDWARPSLMRVDKKTGQNRVRLRGSMLRPSSMVVVH
PLAKPGANPCLHMNGGCDQICENNFGVAYCTCHPGFGKTQDGQTCHPLNASNVTAETISM
QKEAGPMPTPKTSLQSTQSNAIFKGTENGEKKEIEVFLMAEIMISDEDDCAALECDANAQ
CVLLEDGAVCQCLKGFTRKGKSCYDVDECAANMDYCNRNLSGCINIEGGYVCKCLDGYAG
DGLHCEDIDECKMGTHTCGENRTCTNTEGNFTCSCPDGASGTAMGCESTLSPTVVSNEYS
TRPVPGDSIGCPPAYDSYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA
ERVKVRNITIAVCIAVLLLLLGSLAAYCSRSQNFYKKNRYAEVIRDASSHTDNENVTPTC
NKSRFAVVKECSSALETKVLDLIECETANPHPACPSQYVEQPITYDKEAETLVEEKKEQG
CPEDVPSTEKLLEPMVAEKSLSQAAWKAHSKPCQPAPASLLMQPD
NT seq 3738 nt   +upstreamnt  +downstreamnt
atgtttctcttccccgttgctttcttgccagtgatttttactgttgactttgccagccct
tcagctctgcagcactggaactgtcctaatggatacagattaaagagtgaaagctctgcc
tgtgtagatattgacgaatgccttgaaggtggtctgggaacctgtggccaaacctgtaca
aatgtgccaggttcctacttctgctcctgcttgcctggttacaccttggatatcgacaaa
aggtcttgctacgtaaatgaccctgcaccattcctactttttcatcatggaagtgccatc
tacagaattgacactgaagggaccaatcatgaaagattggtggatgatgctggtccatct
ggacttatggattttcattatacagaagagaaagtatactgggtagattcagaaaagcga
cttctgcaaagaattcacctgaatggcacaaaaagagagagattatgttatatagacaaa
ggcatttcaggatttgctattgactggataaaccgggacattctctgggccaacagacag
aaagcaaccatagaagcaacagacatgaatgggaagaaacgccgagttcttctaagagat
attggtcgccccacaaagattgccattgatgctgagcaaaggatactgttttggtcatca
gatggtacagtttccagcatataccgtatgtctctcaatggaagtgatgtgagaaatatt
ttaagaaccacagaaaaaataaaggccatctcactagattttgttgacataaggctctac
tggatccagcatgaccatgggaaagagatttcccatattggatcatgtgactatgaaggg
agtgctgttcatttgctccgaagttctagtcgatatcagttgcttggtatgtctctcttt
gctgaccacctgtactattcggagttgaagtctggtacaatatggacagccaacaagtat
actggaaaggctgtagtcactattagcctaaaaccatcacttttttcactcgtggagata
aaagtagtgcatccatttaaacaacctggtgcaagaacagatctccaggagtttgaaaaa
ggaatctgcgatttgaacaaagaaaagtgcagaagaagaatctgcaggccggactcaagg
actcatcggtgtaaatgttctagtggctctattttaagtcggaataaacagttctgtgaa
gatatcaatgaatgtggcttctggaatcatggctgcactctgggctgtgtgaatatccct
ggttcgtattattgcacgtgccctagaggttttgttctgctgcctgataggaaaacatgt
catgagctgatttcctgtttaaataacgacactgaatgcagccacggttgccttcagaca
tctaaagggcctgtttgcttttgtcctgaaggatctgtactcaaagaggatggcaaagca
tgcacgggttgcacatctccagataatggtggctgtagccagatatgttcttctttaagc
ccattctcctgggagtgtgcttgctttcctggatataagcttcaacgagacagaaagcac
tgcactgctataggccctcgtccatttctgttgtttgcaaacggccaagatatccgccgg
atcagttttgatggaacagattatgcaagtttacttgacgggcagatgggagtagtctta
gcgctggattctgacccagtggaaaataagatttactttgcccacaccgccttgaagtgg
atagaacgagctaatctggatggctcaaatcgtgaaaaagttattcatggagctatagat
atacccgagggccttgctgtggactggattaaccgtaaattgtattggacagaccgaggg
aaggcatgcattgaaaggagcactttgaatggaatgcaaagaaaaatgatcatctgggag
ggtatctcccagccccgagggattgccattcacccctttgtgaggaggttattctggact
gaaatgggcatccgtcccaaaattgccagctcttcattagaaggcatggatcgtcgggtt
atagccagcatgggtctggtgcatcccagtggaatagctcttgactacttagccaacaag
ttgtactggtgcgatgctaagcagtcagtggttgagagtgcaaatctggatggttctggt
cgtcgaattcttgcacagaatgatgtaggccacccctttgctgtagcggtgtttgaggat
cacctttggctttctgactgggctaggccatcactaatgagggttgacaagaagaccggc
caaaacagggtacgtcttcgaggcagcatgctgagaccctcatcaatggttgtagttcat
cctttggcgaaaccaggggcaaatccttgccttcatatgaatggaggctgtgatcagatc
tgtgaaaacaattttggagttgcctattgcacatgccatccaggatttgggaaaactcaa
gatggacaaacctgtcatcctctgaatgcctctaatgtgacagcagaaactatttctatg
cagaaggaggcagggccaatgccaacaccaaagacctcgctccagagcacacagagcaat
gcaatatttaagggtacagaaaatggagaaaagaaggaaattgaagtttttttgatggct
gaaatcatgatatcagatgaagatgactgcgctgcactagaatgtgatgccaatgcacag
tgtgttttgctggaagatggtgctgtatgccagtgtttgaaaggatttaccaggaagggc
aaatcatgctatgatgtcgatgagtgtgctgcaaatatggactactgtaatcgaaacctg
tcgggctgtatcaacattgaagggggctatgtctgtaaatgcctggatggctacgcggga
gatgggctccattgtgaagatattgatgagtgcaagatggggacccacacctgtggagag
aacagaacctgcacaaatacagaaggaaacttcacttgctcctgtcctgatggtgcttct
ggaactgccatgggttgtgagtctactttgtctcctactgttgtcagcaatgaatactca
acacgccctgtgccaggtgactccataggatgcccccctgcctatgattcatactgtctc
catgggggagtgtgcaattatgtttctgacctacaagactatgcctgcaactgtgtgaca
ggctacgttggggagcggtgccagttcagcgacctggagtggtgggagcagcagcacgct
gagcgggtgaaggtgcggaacatcaccatcgccgtgtgcatagcggtgctgctgctgctg
ctggggtcactggccgcctattgctccagaagtcaaaacttctataagaagaaccgttat
gcggaagtgataagagatgccagtagccacactgacaatgagaacgtgacacctacttgc
aacaagtctcggtttgcggttgtcaaggagtgtagcagtgctctggagactaaagtgctt
gatctaattgagtgtgagacagcgaaccctcatcctgcctgtccttcgcaatatgtggaa
cagccaataacatatgacaaagaggcagaaactttggtggaagagaagaaagagcaaggc
tgcccagaagatgttcccagcacagaaaaattgcttgaacccatggtagcagagaagagc
ctttcccaggctgcctggaaagcccactccaagccctgccagcctgccccagccagcctg
ctgatgcagccggactag

DBGET integrated database retrieval system