KEGG   Gallus gallus (chicken): 421096Help
Entry
421096            CDS       T01006                                 

Gene name
RNF138
Definition
(RefSeq) E3 ubiquitin-protein ligase RNF138 isoform X1
  KO
K10668  E3 ubiquitin-protein ligase RNF138 [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:gga04121]
    421096 (RNF138)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     421096 (RNF138)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    421096 (RNF138)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-Di19 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 zf-Nse Prok-RING_4 zf-MIZ zf-RING_4 zf-RING_6 zf-RING_10 U-box zf-rbx1 GAGA zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 421096
NCBI-ProteinID: XP_015138088
CGNC: 11282
Ensembl: ENSGALG00000015163
UniProt: F1NC08
Position
2
AA seq 246 aa AA seqDB search
MAEEAAAARFSEEDFYCPICQEVFKTPVRTMNCQHVFCRKCFLTAMRESGTHCPLCRGSV
TKKERSYPKRALDVESSMKKASGGCRCCEKQVRFSWMRQHYKTCKKYQDEYGVPSVIPKL
QISQDSTGNSSRNDAVSANGEMASNQLRQGNTSGHPTFKCPLCQEANFTRQRLLDHCNNR
HLYQIVPVICPICVSLPWADSSQVTRNLVSHLNLRHQFDYGEFVNYQLDEEAQYRNAVQE
SCHVNF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaagccgccgccgcgcgcttcagcgaggaggatttttactgtcccatctgc
caggaggtgttcaaaacgcccgtgaggactatgaactgccagcacgtattttgcaggaag
tgcttcttgacagctatgagggaaagtggaacgcattgtcctctctgccgggggagtgtg
actaaaaaagagagatcctatcccaaaagggctctagatgtcgaaagcagtatgaagaaa
gcttctggcggctgtagatgctgtgagaagcaggttaggttttcgtggatgagacagcat
tataaaacgtgtaagaagtatcaggatgaatacggtgttccttctgttattccaaaatta
cagatttcccaggattcaacagggaacagtagcaggaatgatgcagtatcagctaatgga
gagatggctagtaatcaattacgccaaggaaatacaagtggacatccaacgttcaaatgc
cccctgtgtcaggaagccaattttaccagacaacgcttgctggatcactgtaataatagg
catctttatcagatagttcctgtaatctgtcctatttgtgtatctctcccttgggcagat
tctagccaggttaccagaaatcttgttagccatctaaatctgagacaccagtttgactat
ggagaatttgtgaattatcagcttgatgaagaagcccaataccgaaatgcagttcaagaa
tcctgtcatgtgaacttttaa

DBGET integrated database retrieval system