KEGG   Gallus gallus (chicken): 424545
Entry
424545            CDS       T01006                                 
Symbol
ADGRL2
Name
(RefSeq) adhesion G protein-coupled receptor L2 precursor
  KO
K04593  adhesion G protein-coupled receptor L2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    424545 (ADGRL2)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    424545 (ADGRL2)
Peptidases and inhibitors [BR:gga01002]
 Mixed peptidases
  Family P2
   424545 (ADGRL2)
G protein-coupled receptors [BR:gga04030]
 Adhesion receptor family
  Latrophilin
   424545 (ADGRL2)
SSDB
Motif
Pfam: Latrophilin OLF 7tm_2 GAIN Gal_Lectin GPS HRM
Other DBs
NCBI-GeneID: 424545
NCBI-ProteinID: NP_001177406
CGNC: 6736
Ensembl: ENSGALG00000036789
UniProt: A0A1D5PBF0
Position
8:complement(17785587..17943285)
AA seq 1461 aa
MVSSGCRMQSFWFLLIISFLQCTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTECFLPDAYKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYIFVCPGTLKAIVDSPYLYEAEQKAGAWCKDPLQAADKIYFMPWTPYRT
DTLIEYASLEDFQNGRQQTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKS
GEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEA
TWETTYDKRAASNAFMICGVLYVVRSVYQDNESETGRNAIDYIYNTRLSRGEHVDVPFPN
QYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQGKMPTTAVTITSSAELYKTTA
STTSTTSQKGPVSTTLAGGTKEGSRGPKPPPPISTTKIPPVTSFFPLPERFCEPTEARGI
SWPQTQRGMMVERPCPKGTRGTASYLCVVLTGTWNPKGPDLSNCTSHWVNQLAQKIRSGE
NAASLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELRPSEKDSAGRSYNKLQK
REKTCRAYLKAIVDTVDNLLRPEALESWKDMNSSEQAHAATMLLDTLEEGAFVLADNLLE
PTRVSMPTENIVLDVAVLITEGQVQDLKFPQGSKGGNSIQLSASTVKQNSRNGLAKLVFI
IYKSLGRFLSTENATIKLGSDFAGRNSTIAVNSHVIAASINKESSRVYLTDPVYFTLEHI
DPDNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTHTTCACSHLTNFAILMAHREIVY
KDGVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFL
IGIDKTEYKIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGY
LFPATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNLIFLVITLCKMVK
HSNTLKPDSSRLENIKSWVLGAFALLCLLGLTWSFGLLFINEGTVVMTYLFTVFNAFQGM
FIFIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRR
MWNDTVRKQSESSFISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCN
APSAPVFNSPGHSLNNARDTSAMDTLPLNGNFNNSYSLRNGDYNDSVQVVDCGLSLNDTA
FEKMIISELVHNNLRGSSKNHNLERTLPAKAVIGGSSSEDDAIVADASSLMHSDTPGLEL
HHKELEAPLIPQRTHSLLYQPQKKVKTEGTDSYVSQLTAEADDHLQSPNRDSLYTSMPNL
RDSPYPESSPDVEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMYYQISRGNSDGYIIPIN
KEGCIPEGDVREGQMQLVTSL
NT seq 4386 nt   +upstreamnt  +downstreamnt
atggtgtcttctggttgcagaatgcaaagtttttggttcctgctcattatcagcttcctg
cagtgtactgaaggtttcagtcgagcagcactaccgtttggtttggttaggagagagctc
tcttgtgaaggctactccattgacctccggtgtccaggaagtgatgttattatgatagaa
agtgctaactatggacggacagatgacaagatttgtgatgctgaccctttccagatggag
aacactgaatgcttccttccagatgcctacaaaattatgacacaaaggtgcaacaaccga
acacagtgtatagtagttactgggtcagatgtgtttcctgatccttgtcctggaacatac
aagtatctagaagttcaatatgaatgtgttccttacatttttgtttgccctggaacgttg
aaagcaattgtggactcaccgtatttatatgaagctgaacaaaaagcaggtgcttggtgc
aaagatcctcttcaggctgcagataaaatatacttcatgccatggactccatatcgcact
gatactttgatagaatatgcttctttggaggacttccaaaatggacgccagcagacaacg
tataaactcccaaatcgagtggatggtactggatttgtagtgtatgatggcgctgtgttt
tttaacaaggaaagaactaggaacatagtaaaatttgacttgaggactagaattaagagt
ggagaggccataatcaattatgctaattaccatgatacttctccatatcgatggggagga
aagaccgacattgacttggcagttgatgaaaatggcttatgggtaatttatgctacggag
cagaacaacgggatgatagtaattagtcagctgaacccctacaccctacgttttgaagca
acatgggagacaacatacgacaaacgggcagcatccaatgcatttatgatatgtggtgtc
ttgtacgttgtccggtcagtgtatcaggacaatgagagcgagacgggcaggaacgccatc
gattacatctataacaccaggttgagcagaggagagcacgtggatgttcctttccccaac
cagtaccagtacatcgctgcagtggattacaaccccagagacaaccagctctatgtgtgg
aataacaacttcattctccgatattctttggaatttggcccacctgatcctgcccaaggt
aagatgcctactacagcagtgacaataacatcttcagcagagctatacaaaaccacagct
tccaccactagcactacgtcacagaaaggtcccgtaagcacaacattagctggaggaaca
aaggaaggaagcagaggacccaagccaccaccacccatttctacaaccaaaattccccct
gtgacgagttttttccctttgccagaaagattctgtgaaccgactgaggccagggggatt
agctggcctcagacacaaagaggaatgatggttgaacggccttgtcccaaaggaacacga
ggaactgcctcgtatctgtgtgtggttttaacgggaacatggaaccccaaaggccctgat
cttagcaactgcacctcacactgggtaaatcagctggctcagaagatcagaagtggagaa
aatgctgctagtctggccaatgaactggctaaacacaccaaaggaccagtcttcgctggc
gatgttagctcatcagtgaggctgatggagcagctcgtggacattttggatgctcagctg
caggaactgcgacccagtgaaaaagattctgctggaaggagttataacaagctccaaaaa
cgagagaagacatgcagggcttaccttaaggcaattgttgacacagtggacaacctgctc
aggcctgaagctctggagtcctggaaagacatgaattcttcagaacaagcccatgcagcc
acaatgctacttgatacattagaagaaggggcttttgtcttggctgataatctcttagaa
ccaaccagagtctcaatgcccacagaaaatatcgttttggatgttgcagtgctcattact
gagggccaggtgcaggacttgaaatttcctcagggcagtaaaggaggcaactcgattcag
ctctctgcaagcactgtgaaacagaacagcagaaatgggctagcaaaactggttttcatc
atttacaaaagtctggggcgttttcttagcacggaaaatgcaaccataaagctgggcagt
gattttgctggtcggaacagtacaattgcagtcaactcccatgtcattgcagcctctatc
aacaaggagtctagccgggtgtacctgactgatcctgtgtattttactctggaacacatt
gatcctgacaattatttcaatgcaaattgttccttctggaactactccgagaggactatg
atgggatactggtcaactcaaggctgcaaattggttgacacaaataaaactcatacaacg
tgtgcttgcagtcacctcaccaactttgcaattcttatggctcatcgggaaattgtgtac
aaagatggagtacacgaattgctcctcactgtcatcacctgggtgggaattgtcatctct
cttgtttgcctggccatctgcatcttcacattctgttttttccgtggcctacaaagtgat
cgtaacactattcacaagaacctttgtatcaacctattcattgctgagttcattttccta
ataggcatcgataagacagagtacaagattgcatgtccaatatttgcaggtctcttacac
tttttcttcctggcagcctttgcctggatgtgtctagaaggagtgcagctttatctaatg
ctagtagaagtatttgaaagtgaatattctaggaagaagtactattatgttgctggctac
ctcttccctgctacagtagttggtgtctcagcagctattgactataagagctatggaaca
gagaaagcttgctggctccatgtagataactattttatatggagtttcattgggcctgtt
acctttattattctgctgaatcttatcttcttggtgatcacattgtgcaaaatggtgaag
cactcaaacactttgaaaccagactctagcaggttggaaaacattaaatcctgggtcctg
ggtgcatttgctctcctgtgtcttcttggcctaacgtggtcatttggcctgctgtttatc
aatgagggaacagttgtgatgacgtatctcttcacagtatttaatgctttccaaggaatg
tttattttcatctttcattgtgcccttcaaaagaaagtacgtaaggaatacggcaaatgc
ttccgacattcctactgctgtggtggactaccaactgagagtcctcacagttcagtgaag
gcatcaacaacaagaactagtgctcgctattcctctggtactcagagtcgtataaggagg
atgtggaatgacactgtgagaaaacaatctgaatcttcttttatctcaggtgacatcaac
agcacttcaacacttaatcaaggaatgactggcaattacctactaacaaaccctcttctt
cgaccacacggcactaacaacccctataacacattgctcgctgaaactgttgtatgtaat
gccccttcagctcctgtgtttaactcaccaggacattcactgaacaatgccagggataca
agtgccatggatactctaccgctaaatggtaatttcaacaacagctactcattgcgcaac
ggtgactataacgacagtgtgcaagttgtagactgtggactaagcctgaatgatactgct
tttgagaaaatgatcatttcagaattagtgcacaacaacctgcggggcagcagcaagaac
cacaacctggagcgcacgctgccagccaaggctgtgatcggcgggagcagcagcgaagat
gacgccatcgtggcagatgcctcgtctttgatgcacagcgacacccctgggctggagctg
caccacaaagagctcgaggccccacttattccccagcggactcactcccttctgtaccag
ccccagaagaaagtgaagactgagggaaccgacagctacgtctcacagctgacagccgag
gctgacgaccacctccagtcccccaacagagactctctttacacaagcatgcccaacctc
agagactctccgtacccagagagcagccccgatgttgaagaagatctctctccttccagg
aggagtgaaaacgaggacatttactacaagagcatgccaaatctaggagctggccatcag
cttcagatgtactatcaaatcagcaggggtaatagcgacggctatataattcccattaac
aaggaaggatgtattccagaaggagatgttagagaaggacaaatgcaactagtgacaagc
ctttaa

DBGET integrated database retrieval system