KEGG   Gallus gallus (chicken): 426806Help
Entry
426806            CDS       T01006                                 

Gene name
GRHPR
Definition
(RefSeq) glyoxylate reductase/hydroxypyruvate reductase
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00260  Glycine, serine and threonine metabolism
gga00620  Pyruvate metabolism
gga00630  Glyoxylate and dicarboxylate metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    426806 (GRHPR)
   00630 Glyoxylate and dicarboxylate metabolism
    426806 (GRHPR)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    426806 (GRHPR)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     426806 (GRHPR)
    1.1.1.81  hydroxypyruvate reductase
     426806 (GRHPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored NAD_binding_2 IlvN TrkA_N
Motif
Other DBs
NCBI-GeneID: 426806
NCBI-ProteinID: XP_424417
CGNC: 4042
Ensembl: ENSGALG00000005423
UniProt: F1NX57
Position
Z
AA seq 326 aa AA seqDB search
MRRAMAVFVTRRIPAEGMRVLSEAAGCRLQQWDSEEPVPRRELLAGVAGKQGLLCLLSDR
IDAEVLDAAGPSLKVISTMSVGFDHLALDEIKKRGIRVGYTPDVLTDATAELSVALLLAT
CRRLPEAVSEVKTGGWTTWKPLWMCGYGLSGSTVGIIGLGRIGQAVARRLKPFGVKNFLY
TGSRPRPENAAEFQAEFVPLTKLAQESDFVVVTCALTPDTQGMCNKDFFSRMKKTSVFIN
TSRGAVVNQEDLYDALVGGQIAAAGLDVTTPEPLPTDHPLLKLRNCVILPHIGSATYATR
STMAVLAADNLLAGLRGEPMPHELLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggcgatggcggtgttcgtgacgcggcggatcccggccgagggaatgcgggtc
ctgtcggaggcggcggggtgccgcttgcagcagtgggactcggaggagcccgtcccgcgg
cgcgagctgctggcgggggttgcgggcaagcaggggctgctgtgcctcctgtccgaccgc
atcgacgccgaggtgctggatgccgctgggccgagcctgaaagtcatcagtaccatgtcc
gtggggttcgaccacctcgccctggacgagatcaagaagcgggggatccgcgtggggtac
acccccgacgtcctgaccgatgccaccgcggagctctccgtggctctgctcctcgccacg
tgccggcggctgccggaggcggtctcggaggtgaagaccggtggctggacgacctggaag
cccctgtggatgtgtggctacgggctgtctggtagtacggtcggcatcataggtctgggg
agaatagggcaggcggtcgcccgccgtctgaagccatttggggtcaagaactttttgtac
actggaagtcgcccgagaccagagaatgctgcagagtttcaagctgagtttgtccctctc
acaaagctggcccaggagtcggactttgtcgtcgtgacatgcgctttgactccggacacc
cagggaatgtgcaacaaggatttcttcagcaggatgaagaagacctctgtgttcatcaac
acgagcagaggggctgtggtgaaccaagaagatctgtatgatgcgttagtcggtggccaa
attgcagctgcaggcctggatgtcacaacgccggagccactgcccaccgaccaccctctg
ctcaaactcaggaactgtgtgatcctgccacacatcgggagtgccacctatgctacacgg
agcaccatggcagtgctggctgctgacaacctgctggccggcctgcgaggcgaacctatg
ccccacgagctgctgctgtga

DBGET integrated database retrieval system