KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1333
Entry
HDEF_1333         CDS       T00911                                 
Symbol
triD
Name
(GenBank) TriD conjugal transfer protein
  KO
K03200  type IV secretion system protein VirB5
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hde00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HDEF_1333 (triD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hde02044]
    HDEF_1333 (triD)
Secretion system [BR:hde02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HDEF_1333 (triD)
SSDB
Motif
Pfam: T4SS Seryl_tRNA_N PI_PP_C NUP120_helical Spectrin CC2-LZ
Other DBs
NCBI-ProteinID: ACQ67974
UniProt: C4K5Y1
Position
1241699..1242445
AA seq 248 aa
MRIKKTLAWGLSALLSTLSSPISEGGILVFDATSKMENARQWAKEAKQWMETVEHYKAQM
NVYKDQLATSTGLRDIQGLLEQGKSLQSEIKTLQNQGISLNDLLTSDNPPRGALDSLYHK
YKSFDVCGDSTSSSKLPASYLNACKQETANKGYMIEQTAEVQKKINVALKDIGHLSHRIA
NAKDSKESQDLANAIQARSVQLNSLTSAWEMNIKAAEQRDKLLSAKREKAFRQHQYNAPL
PKFGDLVP
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaggattaaaaagacattggcatggggattatcggcgctgctctctaccctgtcatcg
ccgatttctgagggcggcatccttgtttttgacgcgacatcaaaaatggaaaatgcccgg
cagtgggcgaaggaagccaagcaatggatggaaaccgttgagcactacaaggcgcagatg
aacgtctacaaagaccagctggctacctcgacagggcttcgtgatattcaggggctactt
gaacagggaaaaagtttacaaagtgaaatcaaaacgttgcagaatcagggcatcagcctt
aatgacctgttaacgtcagataatccgccgaggggggcattggacagtctgtatcataaa
tacaaaagttttgatgtgtgtggcgatagcacttcctcttcaaagttacctgcctcttac
cttaacgcctgcaagcaggaaacggcgaacaagggctatatgattgagcagacggccgag
gtacaaaaaaagatcaatgtggcgctgaaagatattggccacctgtctcatcgcattgcc
aatgctaaagacagcaaggaatcgcaggatttagcaaatgcaatacaggccaggagtgtt
cagctcaattcattgaccagtgcatgggaaatgaacattaaagcagcagaacaacgtgat
aagctcttatcagcgaagcgtgaaaaagcgtttcgtcagcatcaatataatgcgccgtta
ccgaaatttggagatttagtaccatga

DBGET integrated database retrieval system