KEGG   Heliobacterium modesticaldum: HM1_2648
Entry
HM1_2648          CDS       T00653                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
hmo  Heliobacterium modesticaldum
Pathway
hmo00230  Purine metabolism
hmo01100  Metabolic pathways
hmo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hmo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HM1_2648 (xdhA)
Enzymes [BR:hmo01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     HM1_2648 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ABZ85177
UniProt: B0TBG4
Position
complement(2615733..2618027)
AA seq 764 aa
MKSVGRSIPRVDAVAKVKGAAKYVDDHFVPGMLYAKVFRSAIANGWVKRIDVSKAKALPG
VVAVVTYADVPAHTFPTAGHPYSKDPAHQDVADRNLLTRRLRLVGDEIAAVVAVDELTAQ
KALALIEVEYEEYEPLLTAEAALKAGAPEIHAGRGNVLGRGGYELGDLAQAFVESDCVFS
DAFTTQMVAHCAMENYSAYAYMEENGRIVVVSSTQIPHICRRIVGQALGIPWGRVRVIKP
YIGGGFGGKQDAVVEPLVAFLTTVVHGRPVKLEFTREESFIASRVRHPIAFKIKTGVKKD
GTLLARELEIVSINGAYASHGQSIANNAGTKYRQLYAQQAIKCQSTSVYTNLPSAGAMRG
YGIPQVMFALESHMDDVARELGIDPVDFRLKNIIRTGYQDPISGVKVLSNGLAECLQKGR
EIIGWDAKKADASRRKGTKRRGVGVACFTYASGTHPVGLEVAGARIVMNEDGSVQLQVGA
TEIGQGSDTVFTQMVAETVGIPPSMVHILSEQDTDISPVDLGSYASRQTYITGMAVRKAA
EAIKAKVLDYAWGMTDIPAGAMDIVDGWLVYKHNGEGILPIGEVALDAHTNTAYCQPFTA
DVSNNARVNAFAYGCTFVEVEVDLLMGKVEVLEIHNVHDSGKIINPQLAAGQVHGGVSMG
IGYALYEQMLFDPKTGKPLIHNLLDYKLMTALDTPEIGVHFVEPYEPTGPYGNKALGEPP
TITPAPAIRNAILDATGVAFNDLPLTPQRLIARFQAEGLIEKEG
NT seq 2295 nt   +upstreamnt  +downstreamnt
atgaaaagcgtaggccggagcatcccccgtgtcgacgctgtggccaaggtgaaaggcgcc
gcgaaatatgttgacgatcactttgttcccggcatgctctatgccaaggtctttcgcagc
gccattgccaacggctgggtgaagcgcatcgacgtcagcaaggccaaggcgctgccgggc
gtcgtcgccgtcgtcacctatgcggatgtgcccgctcacaccttcccgacggccggccat
ccctactcgaaggatcctgctcaccaggacgtggctgaccgcaacctgttgacgcgccgc
cttcgcctcgtcggtgatgagatcgccgctgtggtggccgtcgatgagttgacggcgcaa
aaggcattggccttgattgaagtggaatacgaggagtatgaaccgctgttgacagccgag
gcagccctcaaggcgggcgcgccggagatccacgccggcaggggcaacgtgctggggcga
ggcggttacgaattaggcgatctggctcaggccttcgtcgagtcggactgcgtcttttcc
gacgccttcacgacccagatggttgcccactgcgccatggagaactacagcgcctacgcc
tacatggaggaaaacggccgcatcgtcgttgtttcttccacccagatcccccacatctgc
cggcggatcgttggtcaggccctcggcatcccctggggccgcgttcgcgtgatcaaaccc
tacataggtggcggcttcggcggcaagcaggacgctgtcgtggagccgcttgtcgctttt
ctcaccaccgtcgtccatggccgtcccgtcaaactggaattcacccgggaagagagcttc
atcgcctcccgggtgcgccatcccatcgcctttaagatcaagacaggtgtcaaaaaagac
ggcaccctgttggcgcgcgagttggagatcgtctccatcaacggcgcctacgcctctcac
ggtcagtccatcgctaacaacgccggcaccaagtaccgccagctctacgcccagcaggcg
atcaaatgtcagtccacctcggtctatacgaacctgccctccgccggggccatgcgcggt
tacggcatccctcaggtcatgtttgctttagagagccatatggacgatgtggcccgggaa
ctggggatcgaccccgtcgattttcgcctgaagaatatcatccgtaccggttaccaggat
ccgatcagcggcgtcaaggtgctcagcaacggtttggccgagtgcctgcaaaagggccga
gaaatcatcggctgggacgccaaaaaagccgacgccagccggcggaaggggacgaaacgg
cgtggcgtcggcgtagcctgtttcacctacgcctcaggcactcatcccgtcggccttgag
gtggctggcgcgcggatcgtcatgaatgaagatggttcggtccagcttcaggtgggtgct
accgagatcggccagggcagcgacaccgttttcacccagatggtggctgagacagtcggc
attcccccctcgatggtccatatcctctccgaacaggacacagacatctcgcctgtcgat
ctgggctcctacgcttcccggcagacctacatcaccggcatggccgtgcgcaaggccgcc
gaagcgatcaaggccaaggtcctcgactatgcctggggtatgaccgatatcccggccggc
gccatggacatcgtcgacggctggctcgtctacaagcacaacggcgaagggatcctgccc
atcggcgaggtggccctcgacgcgcacacgaacacggcctattgccaaccctttacggcc
gatgtctccaacaacgctcgcgtcaacgcctttgcctacggctgcactttcgtcgaggtt
gaggtcgacctgttgatgggcaaggtcgaggtcctggagatccacaacgtccacgactct
ggcaagatcatcaatcctcagttggctgccggccaggtccatggcggtgtcagcatgggg
atcggctacgccctttacgagcagatgctctttgaccccaagacgggaaaacccctcatc
cataacctcctcgactacaagctgatgaccgccctcgacacccctgagatcggcgttcat
ttcgtcgagccctatgagccgacagggccctacggcaacaaagccctgggcgagccgccg
actatcacgccggcgccggccatccgcaacgccatccttgacgccaccggcgtggccttt
aacgacctgccgctcacaccccagcgcctgatcgcccgctttcaggcggaagggctgatc
gaaaaggagggatga

DBGET integrated database retrieval system