KEGG   Hafnia paralvei: AL518_08160
Entry
AL518_08160       CDS       T05667                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
hpar  Hafnia paralvei
Pathway
hpar00230  Purine metabolism
hpar01100  Metabolic pathways
hpar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AL518_08160
Enzymes [BR:hpar01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AL518_08160
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AMH17989
UniProt: A0A2A2MDG5
Position
complement(1832841..1835126)
AA seq 761 aa
MSLGSPLKRVDAEAKVTGRARYTDDHQMPGMRYAKYVRSPVAHAKVTAIDTSAALAMPGV
EAIFTFKDVPELLFPTAGHAWSLEAAKRDVADRSLLTQHVRHFGDGVAIVVARDALTAER
AAALVDVTYQELPVITNAQAALAEGATPIHPTGNILKKSDISANQPTEAISAADLQLCAH
FQTPVIQHCHMESVTCFAYMEQPDHIVIVSSTQIPQIVRRTVAQALGLPWSNIRVIKPYI
GGGFGNKQDVLEEPMAAFLTLKMGGIPVKVELSREECFFASRTRHAFSIDAKLGLNKDGI
LTGYQLDVLSNTGAYASHGHSIASAGANKISYLYPRSAFGYSALTHYSNYPAAGAMRGYG
APQVAFALECLLDDAAEKLALDAVEVRLLNAARSGDINPVNHKTIYSAGLVECLEKGRDM
FEWDARKAECLQQNGDVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGATE
IGQGSDTVFAQMAAETLGLPFEHIRVISTQDTDITAYDPGAFASRQSYVAAPAVRQAATE
LRSKILAHAELISHQPQWGLTLLDGNVVMAAQPEMVLMSVADVSMHAYYHQEIGAQLLAE
ISHKTTTNPPAFGCTFVDLTIDIPLCKVTINKILNMHDSGRILNPQLAEGQVHGGMGMGI
GWALFEEMIIDEKTGVVRNPNLLDYKFPTIMDLPDLDCAFVDTYEPQSAYGHKALGEPPI
ISPAPAIRNAIRMATGVAINTLPITPKTLFNEFVLAGLIRE
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgtcgttaggatcaccactcaagcgggttgatgctgaagcaaaggttaccggacgcgcc
cgttataccgacgatcatcaaatgccggggatgcgctatgccaaatacgtacgcagtcct
gttgcccatgcgaaggtcaccgctattgatacttctgctgcgcttgccatgccaggcgta
gaagcgatttttacctttaaagatgtgcccgaactcctcttccctaccgctgggcacgct
tggtccttagaggccgccaaacgtgacgttgccgaccgtagtctgttgacccagcacgtc
cgccattttggtgatggggtggcgattgtggtcgccagagatgcgcttacggcagaacgc
gccgcagcacttgtggacgtgacctatcaagaattaccggtcatcactaatgcccaagcc
gcactggcagaaggcgcaacgcccatccatccaacgggtaacatactgaaaaaaagcgac
atcagcgctaatcagcccacagaggcgatctcggcggctgatttacagctctgcgctcac
tttcaaacgccagtgattcagcattgccacatggaaagcgtgacctgcttcgcttatatg
gagcagcccgatcacattgtgattgtgtccagcacccaaattcctcaaatcgttcgccgc
accgttgctcaagcgttgggattaccatggtcaaatattcgcgtgattaaaccctatatt
ggcggtggttttggtaacaagcaggacgttttagaagaacctatggcagcgtttctaacg
ctgaaaatgggggggattccggttaaagtcgaattgagtcgtgaagagtgtttttttgcc
tctcggactcggcatgcatttagcattgatgccaagttagggctcaataaagacggcata
ctcacgggctatcagcttgatgtgctctccaataccggcgcttacgcttctcatgggcac
tctattgcatctgccggtgccaacaaaattagctatctctatccccgcagtgcctttggc
tattcggccctcacccactattccaactatcctgccgcgggtgccatgcggggatacggt
gcgcctcaggtcgcttttgcccttgagtgcttattagatgatgccgccgaaaaactcgcg
ctggatgccgtagaggtgcgcttactgaatgccgcacgcagcggcgatattaatccggtt
aaccacaaaaccatatacagcgctggattagtcgaatgcttggaaaaaggccgcgacatg
tttgagtgggacgcgcgcaaagccgaatgcctgcagcaaaacggagatgtgcggcgcggc
attggcgttgcctgcttcagctatggctccaatacctatccggtcggcgttgaaattgcg
ggcgctcgaatgctgcttaatcaagacggtacggtcaatctgcaaatcggcgcgacggaa
attgggcaaggctcggataccgtattcgctcagatggcggcggaaacgctaggactccct
tttgagcatattcgcgtcatctccacccaagacaccgatattaccgcctacgatccgggc
gcatttgcatcgcgtcagagttacgtagcagcgcccgcggttagacaggcggcaaccgag
ctgcgtagcaaaattctggctcatgccgagttgattagccaccagcctcagtgggggctt
acgctactcgatggaaatgtggtgatggccgcgcagcctgaaatggtactgatgagcgtc
gctgacgtctctatgcatgcctattatcatcaggaaatcggcgctcagttgctggctgaa
atctcgcacaaaaccacgactaacccaccggcttttggctgcacctttgtcgacctcact
atcgatattcctttgtgcaaagtcaccatcaacaagatcctcaatatgcatgattctggc
cgaattcttaaccctcagttagcggaaggtcaggtacatggcggcatgggaatgggaatt
ggttgggcgctgtttgaggagatgatcatcgatgagaaaaccggtgtagtacgcaatcca
aacctgctggactataagttccccaccattatggatctgcccgatctggactgtgccttt
gttgacacctacgaaccgcagtctgcgtatgggcataaagcactgggtgaaccaccgatt
atctcgcccgctccggcaatcaggaatgcaatccgcatggcgaccggcgtggcaattaac
accttgcccatcacgcctaaaacgctgtttaacgaatttgttctcgccggactcatcagg
gagtaa

DBGET integrated database retrieval system