KEGG   Helicobacter pylori PeCan4: HPPC_02585Help
Entry
HPPC_02585        CDS       T01322                                 

Definition
(GenBank) cag pathogenicity island protein Z
  KO
K12091  cag pathogenicity island protein 6
Organism
hpc  Helicobacter pylori PeCan4
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02585
Secretion system [BR:hpc02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPPC_02585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagZ Lipoprotein_7
Motif
Other DBs
NCBI-ProteinID: ADO06757
UniProt: E1Q614
Structure
PDB: 

Position
complement(507507..508106)
Genome map
AA seq 199 aa AA seqDB search
MELGFNEAERQKILDSNKSLMGNADEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQ
KNFISFDAYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEV
ARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKT
YLTSLERAKLITQLKLNLE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggaactcggttttaatgaagcagaaagacaaaagatcttagatagcaacaaatctctt
atgggaaatgcagatgaagtaagggataagtttattcaaaattacgcctcttctttaaaa
gatagcaacgatccgcaagattttttgagaagagttcaagagttaagaatcaatatgcaa
aagaattttattagttttgatgcttattacaactatttgaacaatcttgtgttagccagt
tacaatcgttgcaaacaagaaaaaacttttgcagaaagcacgatcaaaaatgaactaacg
cttggagagtttgttgcagaaatttctgacaacttcaataatttcatgtgtgatgaagtg
gcaagaatttcagacctagtggcttcttatctgccaagagagtatttaccgccattcata
gatggcaatatgatgggcgtggcgtttcagattctagggatagatgattttgggagaaag
ctcaatgagattgtccaagatatagggactaaatatatcattttgagcaaaaataagact
tatctcacttctttagaaagagctaaattgataacccaattaaaattaaatttggaataa

DBGET integrated database retrieval system