KEGG   Helicobacter pylori PeCan4: HPPC_02605
Entry
HPPC_02605        CDS       T01322                                 

Definition
(GenBank) cag pathogenicity island protein X
  KO
K12093  cag pathogenicity island protein 8
Organism
hpc  Helicobacter pylori PeCan4
Module
hpc_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpc02044]
    HPPC_02605
Secretion system [BR:hpc02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPPC_02605
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ADO06759
UniProt: E1Q616
Structure
PDB: 
5H3V 6OEG

Position
complement(513792..515357)
AA seq 521 aa
MEQAFFKKIVNCFCLGYLFLSSVIEAAPDIKNFNRGRVKVVNKKIAYLGDEKPITIWTSL
DNVTVIQLEKDETISYITTGFNKGWNIVPNSNHIFIQPKSVKSNLMFEKEAVNFALMTRD
YQEFLKTKKLIVDAPDPKELEEQKKALEKEKEAKEQAQKAQKDKREKRKEERAKNRANLE
NLTNAMSNPQNLSNNKNLSELIKQQRENELDQMERLEDMQEQAQANALKQIEELNKKQAE
ETIKQRAKDKISIKTDKSQKSPEDNSIELSPSDSAWRTNLVVRTNKALYQFILRIAQKDN
FASAYLTVKLEYPQRHEVSSVIEEELKKREEAKRQRELIKQENLNTTAYINRVMMASNEQ
IINKEKIREEKQKIILDQAKALETQYVHNALKRNPVPRNYNYYQAPEKRSKHIMPSEIFD
DGTFTYFGFKNITLQPAIFVVQPDGKLSMTDAAIDPNMTNSGLRWYRVNEIAEKFKLIKD
KALVTVINKGYGKNPLTKNYNIKNYGELERVIKKLPLVRDK
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggagcaggcattttttaaaaaaattgttaactgtttctgtcttggttatttattttta
tctagcgtaatagaagcagcacctgacattaaaaattttaatcgtggcagggtgaaagtg
gtgaataagaagattgcttatttgggagatgaaaaacccatcacgatttggacttcatta
gacaatgttactgtgatccaacttgaaaaagatgaaactatttcttacatcacaacaggt
ttcaataaaggttggaatattgtgcctaattctaatcatatattcattcaacctaaatcg
gtaaaaagtaatctcatgtttgaaaaagaagcagtgaattttgccctaatgacaagagat
taccaagaatttttaaaaacaaaaaaacttatcgtagatgcgcctgaccctaaagaatta
gaagaacaaaaaaaagctctagaaaaagaaaaagaagctaaagaacaggcgcaaaaagcg
caaaaagataaaagagaaaaaagaaaggaggagcgtgcaaaaaatagagccaatttagaa
aatctcactaacgctatgagtaacccacaaaatttgagcaataacaaaaatcttagcgaa
ttgatcaagcaacagagagaaaatgaattagaccaaatggaacgactagaagacatgcaa
gagcaggctcaagctaacgcgctcaaacaaattgaagaactcaacaagaaacaagctgaa
gagacaatcaagcaaagagccaaagataaaatcagtattaagacagataaatctcaaaaa
agccccgaggataactccatagaattatctcctagcgatagcgcttggagaaccaatctt
gttgtgcggactaataaagccttgtatcaattcattttgaggatagctcaaaaagacaat
tttgcttcggcgtatctaacagtcaaattagaatacccacaaagacacgaagtctctagc
gttattgaagaggaattaaaaaagagagaagaagcaaagaggcagagagaattgatcaag
caagaaaatctcaacaccacagcctacatcaatagagtaatgatggcgagcaatgaacag
attatcaacaaagaaaaaataagagaagaaaaacaaaaaattatactagatcaagcaaag
gcactagagacccaatatgtgcataatgcgttaaaaagaaaccctgtgcctagaaactac
aattactaccaagcgcctgaaaaacgctctaaacatattatgccctctgaaatttttgat
gatggcacattcacttattttggtttcaaaaacatcactctccaacctgctatttttgtg
gttcaacctgatgggaaattaagcatgactgatgctgctattgatcctaacatgaccaat
tcaggattgagatggtatagagttaatgaaattgcagaaaagtttaagctcattaaagac
aaagcccttgtaacagtaataaataaaggctatgggaaaaatccattgacaaaaaattac
aatatcaaaaactatggtgaattggagcgtgtgattaaaaagctccctcttgtcagagat
aaataa

DBGET integrated database retrieval system