KEGG   Homo sapiens (human): 8321Help
Entry
8321              CDS       T01001                                 

Gene name
FZD1
Definition
(RefSeq) frizzled class receptor 1
  KO
K02432  frizzled 1/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8321 (FZD1)
   04390 Hippo signaling pathway
    8321 (FZD1)
   04150 mTOR signaling pathway
    8321 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8321 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8321 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8321 (FZD1)
   05205 Proteoglycans in cancer
    8321 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    8321 (FZD1)
   05226 Gastric cancer
    8321 (FZD1)
   05217 Basal cell carcinoma
    8321 (FZD1)
   05224 Breast cancer
    8321 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8321 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8321 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8321 (FZD1)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8321 (FZD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 8321
NCBI-ProteinID: NP_003496
OMIM: 603408
HGNC: 4038
Ensembl: ENSG00000157240
Vega: OTTHUMG00000023046
Pharos: Q9UP38(Tbio)
UniProt: Q9UP38
Position
7q21.13
AA seq 647 aa AA seqDB search
MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLW
LLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPIS
IPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL
EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP
SLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPC
EPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSG
CYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWW
VILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVG
LNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVF
SVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDF
TVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgggccgccggcggtggcgcgagctgggaa
ctttgtgccggggcgctctcggcccggctggcggaggagggcagcggggacgccggtggc
cgccgccgcccgccagttgacccccggcgattggcgcgccagctgctgctgctgctttgg
ctgctggaggctccgctgctgctgggggtccgggcccaggcggcgggccaggggccaggc
caggggcccgggccggggcagcaaccgccgccgccgcctcagcagcaacagagcgggcag
cagtacaacggcgagcggggcatctccgtcccggaccacggctattgccagcccatctcc
atcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctgggccac
acgaaccaggaggacgcgggcctggaggtgcaccagttctaccctctagtgaaagtgcag
tgttccgctgagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgcta
gagcaggcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggctgcgaggcg
ctcatgaacaagttcggcttccagtggccagacacgctcaagtgtgagaagttcccggtg
cacggcgccggcgagctgtgcgtgggccagaacacgtccgacaagggcaccccgacgccc
tcgctgcttccagagttctggaccagcaaccctcagcacggcggcggagggcaccgtggc
ggcttcccggggggcgccggcgcgtcggagcgaggcaagttctcctgcccgcgcgccctc
aaggtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgcaccttgt
gagccgaccaaggtgtatgggctcatgtacttcgggcccgaggagctgcgcttctcgcgc
acctggattggcatttggtcagtgctgtgctgcgcctccacgctcttcacggtgcttacg
tacctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcttgtccggc
tgttacacggccgtggccgtggcctacatcgccggcttcctcctggaagaccgagtggtg
tgtaatgacaagttcgccgaggacggggcacgcactgtggcgcagggcaccaagaaggag
ggctgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatctggtgg
gtgatcctgtcgctcacctggttcctggcggctggcatgaagtggggccacgaggccatc
gaagccaactcacagtattttcacctggccgcctgggctgtgccggccatcaagaccatc
accatcctggcgctgggccaggtggacggcgatgtgctgagcggagtgtgcttcgtgggg
cttaacaacgtggacgcgctgcgtggcttcgtgctggcgcccctcttcgtgtacctgttt
atcggcacgtcctttctgctggccggctttgtgtcgctcttccgcatccgcaccatcatg
aagcacgatggcaccaagaccgagaagctggagaagctcatggtgcgcattggcgtcttc
agcgtgctgtacactgtgccagccaccatcgtcatcgcctgctacttctacgagcaggcc
ttccgggaccagtgggaacgcagctgggtggcccagagctgcaagagctacgctatcccc
tgccctcacctccaggcgggcggaggcgccccgccgcacccgcccatgagcccggacttc
acggtcttcatgattaagtaccttatgacgctgatcgtgggcatcacgtcgggcttctgg
atctggtccggcaagaccctcaactcctggaggaagttctacacgaggctcaccaacagc
aaacaaggggagactacagtctga

DBGET integrated database retrieval system