KEGG   Homo sapiens (human): 84676Help
Entry
84676             CDS       T01001                                 

Gene name
TRIM63, IRF, MURF1, MURF2, RNF28, SMRZ
Definition
(RefSeq) tripartite motif containing 63
  KO
K10655  tripartite motif-containing protein 63 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    84676 (TRIM63)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     84676 (TRIM63)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    84676 (TRIM63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_UBOX zf-C3HC4_2 zf-C3HC4 zf-RING_5 zf-B_box zf-RING_2 zf-C3HC4_3 zf-C3HC4_4 zf-RING_6 YceG_bac DUF745 ATP-synt_E_2 DUF1664 Fzo_mitofusin Phasin Spt4 Allexi_40kDa DUF349 PfkB
Motif
Other DBs
NCBI-GeneID: 84676
NCBI-ProteinID: NP_115977
OMIM: 606131
HGNC: 16007
Ensembl: ENSG00000158022
Vega: OTTHUMG00000007510
Pharos: Q969Q1(Tbio)
UniProt: Q969Q1
Structure
PDB: 

Position
1p36.11
AA seq 353 aa AA seqDB search
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWT
SRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHP
MCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQSVFQGQKTELNNCISMLVAG
NDRVQTIITQLEDSRRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLS
FIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGHQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggattataagtcgagcctgatccaggatgggaatcccatggagaacttggagaagcag
ctgatctgccctatctgcctggagatgtttaccaagccagtggtcatcttgccgtgccag
cacaacctgtgccggaagtgtgccaatgacatcttccaggctgcaaatccctactggacc
agccggggcagctcagtgtccatgtctggaggccgtttccgctgccccacctgccgccac
gaggtgatcatggatcgtcacggagtgtacggcctgcagaggaacctgctggtggagaac
atcatcgacatctacaaacaggagtgctccagtcggccgctgcagaagggcagtcacccc
atgtgcaaggagcacgaagatgagaaaatcaacatctactgtctcacgtgtgaggtgccc
acctgctccatgtgcaaggtgtttgggatccacaaggcctgcgaggtggccccattgcag
agtgtcttccagggacaaaagactgaactgaataactgtatctccatgctggtggcgggg
aatgaccgtgtgcagaccatcatcactcagctggaggattcccgtcgagtgaccaaggag
aacagtcaccaggtaaaggaagagctgagccagaagtttgacacgttgtatgccatcctg
gatgagaagaaaagtgagttgctgcagcggatcacgcaggagcaggagaaaaagcttagc
ttcatcgaggccctcatccagcagtaccaggagcagctggacaagtccacaaagctggtg
gaaactgccatccagtccctggacgagcctgggggagccaccttcctcttgactgccaag
caactcatcaaaagcattgtggaagcttccaagggctgccagctggggaagacagagcag
ggctttgagaacatggacttctttactttggatttagagcacatagcagacgccctgaga
gccattgactttgggacagatgaggaagaggaagaattcattgaagaagaagatcaggaa
gaggaagagtccacagaagggaaggaagaaggacaccagtaa

DBGET integrated database retrieval system