KEGG   Homo sapiens (human): 100129543
Entry
100129543         CDS       T01001                                 
Symbol
ZNF730
Name
(RefSeq) zinc finger protein 730
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100129543 (ZNF730)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100129543 (ZNF730)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100129543 (ZNF730)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 XPA_N Zn-ribbon_8 zf-RING_7 zf-C2H2_jaz zf_UBZ zf-C2H2_11 zf-AN1 TBPIP_C Zn_ribbon_SprT Evr1_Alr DNA_RNApol_7kD
Other DBs
NCBI-GeneID: 100129543
NCBI-ProteinID: NP_001264332
HGNC: 32470
Ensembl: ENSG00000183850
UniProt: Q6ZMV8
Position
19:23075211..23147221
AA seq 503 aa
MGALTFRDVAIEFSLEEWQCLDTEQQNLYRNVMLDNYRNLVFLGIAVSKPDLITCLEQEK
EPWNLKTHDMVAKPPVICSHIAQDLWPEQGIKDYFQEVILRQYKKCRHENLLLRKGCKNV
DEFKMHKKGYNRHNQCLTTSHSKIFQCDKYVKVFHKFSNSNRHKIRHTSKKPFKCKECGK
LFCILSHLAQHKKIHTGEKSYKCEEYGKAFNESSNCTTHKRITEKKPYKCKECGKAFNWF
SHFTTHKRIHTGEKPYQCEKCGKFFNQSTNLTTHKRIHTGEKPYKCEECGKAFNQSSNLT
EHKKIHTKEQPYKCEKCGKAFKWSSTLTKHKRIHNGEKPYKCEECGKAFNRSSTLNRHKI
THTGGKPYKYKECGKAFNQSSTLTIHKIIHTVEKFYKCEECGKAFSRISHLTTHKRIHTG
EKPYKCEECGRAFNQSSTLTTHKRIHTGEKPYECEECGKAFNRSSTLTTHKIIHSGEKIY
KCKECGKAFRRFSHLTRHKTIHT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgggagcgttgacatttagagatgtggccatagaattctctctggaggagtggcaatgt
ctggacaccgaacaacagaatttatatagaaatgtaatgttagataactacagaaacctg
gtcttcctgggtattgctgtctcaaagccagacctgatcacctgtctggagcaagaaaaa
gagccttggaatttgaagacacatgatatggtagccaaacccccagttatatgttctcat
attgcccaagacctttggccagagcaaggcataaaagattatttccaagaagtcatactg
agacaatataaaaaatgtagacatgagaatttactgttaagaaaaggctgtaaaaatgtg
gatgagtttaagatgcacaaaaaaggttataatagacataaccagtgtttgacaacttcc
catagcaaaatatttcagtgtgacaaatatgtgaaagtctttcataaattttcaaattca
aacagacataagataagacatacttcgaagaaacctttcaaatgtaaagaatgtggaaaa
ttattttgcattctttcacacttagctcaacataaaaaaattcatactggagagaaatcc
tacaaatgtgaagaatatggcaaagcctttaatgagtcctcaaactgtactacacataaa
agaattactgagaaaaaaccttacaaatgtaaagaatgtggcaaagcctttaactggttt
tcacattttactacacataagagaattcatactggagaaaaaccctaccaatgtgagaaa
tgtggcaaattttttaaccaatccacaaaccttactacacataaaagaattcatactgga
gagaaaccctataaatgtgaagaatgtggcaaagcctttaaccagtcctcaaaccttact
gaacataagaaaattcatactaaagagcaaccatacaaatgcgaaaaatgtggcaaagct
tttaagtggtcctcaacccttacaaaacataaaagaattcataatggagaaaaaccctac
aaatgtgaagaatgtggcaaagcttttaaccgatcctcaacccttaatagacataagata
actcatactggagggaaaccctacaaatataaagaatgtggtaaagcttttaaccaatcc
tcaactcttactatacataagataattcatactgtagagaaattttacaaatgtgaagaa
tgtggcaaagcctttagccgtatctcacaccttactacacataagagaattcatactgga
gagaaaccctacaaatgtgaagaatgtggcagagctttcaaccagtcctcaacccttact
acacataaaagaattcatactggagagaaaccctatgaatgtgaagaatgtggcaaagct
tttaaccggtcctcaaccctcactacacataagataattcattctggggaaaaaatctac
aaatgtaaagaatgtggtaaagcctttaggcggttctcacaccttactaggcataagaca
attcatacataa

DBGET integrated database retrieval system