KEGG   Homo sapiens (human): 100129842
Entry
100129842         CDS       T01001                                 
Symbol
ZNF737, ZNF102
Name
(RefSeq) zinc finger protein 737
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100129842 (ZNF737)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    100129842 (ZNF737)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    100129842 (ZNF737)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz XPA_N Zn-ribbon_8 zf-RING_7 Zn_ribbon_SprT
Other DBs
NCBI-GeneID: 100129842
NCBI-ProteinID: NP_001152765
OMIM: 603984
HGNC: 32468
Ensembl: ENSG00000237440
UniProt: O75373
Position
19:complement(20530276..20565781)
AA seq 536 aa
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYRNLVFLGIVVSKPDLITCLEQGK
KPLTMKKHEMVANPSVTCSHFARDLWPEQSIKDSFQKVTLRRYENYGHDNLQFKKGCESV
DECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKCIECGK
AFNQSSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKRIHTGEKRYKCEDCGKAFSR
FSYLTAHKIIHSGEKPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCEECGKAFKRSSIL
TAHKIIHSGEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCEECGRAFKYFSSLTTHK
IIHSGEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCEECGEAFKYSSSLTTHKIIHT
GQQPFKCEECGKAFKCFSILTTHKRIHTGEKPYKCEECGKAFNSSSHLTAHKRIHTGEKP
YKCERCGKAFKRSFILTRHKRIHTGEKPYKCEECGKGFKCPSTLTTHKVIHTGEKL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggggccattgcaatttagagacgtggccatagaattctctctggaggagtggcattgc
ctggacactgcacagcggaatttatataggaatgtgatgttagagaactacagaaacctg
gtcttccttggtattgttgtctctaagccagacctcatcacctgtctggagcaaggaaaa
aaacctttgaccatgaagaaacatgagatggtagccaacccctcagttacgtgttctcat
tttgcccgagatctttggccagagcagagcataaaagattctttccaaaaagtgacactg
agaagatatgaaaactatggacatgacaatttacagtttaaaaagggctgtgaaagtgta
gatgagtgtaaggtgcacaaaagaggttataatggacttaaccaatatttgacaactact
caaagcaaaatatttcagtgtgataaatatgtgaaagtcattcataaattttcaaattca
aacagacataagataagacatactggaaaaaaacctttcaaatgtatagaatgtggcaaa
gcttttaaccagtcttcaacccttactacacataagaaaattcatactggggagaaaccc
ttcaaatgtgaagaatgtggcaaagccttcaactggtcctcacaccttactacacataag
agaattcatactggagagaaacggtacaaatgtgaagactgtggcaaagcctttagccgg
ttttcataccttactgcacataagataattcatagtggagagaaaccctacaaatgtgaa
gaatgtggcaaggcctttaagcgctcctctaaccttactacacataagataattcatact
ggagagaaaccctacaaatgtgaagaatgtggcaaggcctttaagcgctcctctatcctt
actgcgcataagataattcatagcggagagaaaccctacaaatgtgaagaatgtggcaaa
gcctttaagcacccctctgtccttactacacataaaagaattcatactggagagaaaccc
tacaaatgtgaagaatgtggcagagcctttaagtacttctcatcccttactacacacaag
ataattcatagtggagagaaaccctacaaatgtgaagaatgtggcaaagccttcaactgg
tcctcacaccttactacacataagagaattcatactggagagaaaccctacaaatgtgaa
gaatgtggcgaagcctttaagtactcctcttcccttactacacataagataatccatact
ggacagcaacccttcaagtgtgaagaatgtggcaaggcctttaagtgcttctctatcctt
actacacataagagaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaa
gccttcaactcgtcctcacaccttactgcacataagagaattcatactggagagaaaccc
tacaaatgtgaacgatgtggcaaggcttttaagcgctcctttatccttactagacataag
agaattcatactggagagaaaccctacaaatgtgaagaatgtggcaaaggctttaagtgc
ccctctacccttactacacataaggtaattcatactggagagaaactataa

DBGET integrated database retrieval system