KEGG   Homo sapiens (human): 10014
Entry
10014             CDS       T01001                                 
Symbol
HDAC5, HD5, NY-CO-9
Name
(RefSeq) histone deacetylase 5
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870<US>
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019<JP/US> D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637<JP/US>
Vorinostat: D06320<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    10014 (HDAC5)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    10014 (HDAC5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    10014 (HDAC5)
   05203 Viral carcinogenesis
    10014 (HDAC5)
  09165 Substance dependence
   05034 Alcoholism
    10014 (HDAC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10014 (HDAC5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     10014 (HDAC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     10014 (HDAC5)
SSDB
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Other DBs
NCBI-GeneID: 10014
NCBI-ProteinID: NP_005465
OMIM: 605315
HGNC: 14068
Ensembl: ENSG00000108840
Pharos: Q9UQL6(Tclin)
UniProt: Q9UQL6
Structure
Position
17:complement(44076753..44123641)
AA seq 1122 aa
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggatgggatgtcaggtcgggaaccatccttggaaatcctg
ccgcggacttctctgcacagcatccctgtgacagtggaggtgaagccggtgctgccaaga
gccatgcccagttccatggggggtgggggtggaggcagccccagccctgtggagctacgg
ggggctctggtgggctctgtggaccccacactgcgggagcagcaactgcagcaggagctc
ctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccagaaa
cagcatgaccacctgacaaggcagcatgaggtccagctgcagaagcacctcaagcagcag
caggagatgctggcagccaagcagcagcaggagatgctggcagccaagcggcagcaggag
ctggagcagcagcggcagcgggagcagcagcggcaggaagagctggagaagcagcggctg
gagcagcagctgctcatcctgcggaacaaggagaagagcaaagagagtgccattgccagc
actgaggtaaagctgaggctccaggaattcctcttgtcgaagtcaaaggagcccacacca
ggcggcctcaaccattccctcccacagcaccccaaatgctggggagcccaccatgcttct
ttggaccagagttcccctccccagagcggcccccctgggacgcctccctcctacaaactg
cctttgcctgggccctacgacagtcgagacgacttccccctccgcaaaacagcctctgaa
cccaacttgaaagtgcgttcaaggctaaaacagaaggtggctgagcggagaagcagtccc
ctcctgcgtcgcaaggatgggactgttattagcacctttaagaagagagctgttgagatc
acaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcacccggctccggccccagc
tctcccaacagctcccacagcaccatcgctgagaatggctttactggctcagtccccaac
atccccactgagatgctccctcagcaccgagccctccctctggacagctcccccaaccag
ttcagcctctacacgtctccttctctgcccaacatctccctagggctgcaggccacggtc
actgtcaccaactcacacctcactgcctccccgaagctgtcgacacagcaggaggccgag
aggcaggccctccagtccctgcggcagggtggcacgctgaccggcaagttcatgagcaca
tcctctattcctggctgcctgctgggcgtggcactggagggcgacgggagcccccacggg
catgcctccctgctgcagcatgtgctgttgctggagcaggcccggcagcagagcaccctc
attgctgtgccactccacgggcagtccccactagtgacgggtgaacgtgtggccaccagc
atgcggacggtaggcaagctcccgcggcatcggcccctgagccgcactcagtcctcaccg
ctgccgcagagtccccaggccctgcagcagctggtcatgcaacaacagcaccagcagttc
ctggagaagcagaagcagcagcagctacagctgggcaagatcctcaccaagacaggggag
ctgcccaggcagcccaccacccaccctgaggagacagaggaggagctgacggagcagcag
gaggtcttgctgggggagggagccctgaccatgccccgggagggctccacagagagtgag
agcacacaggaagacctggaggaggaggacgaggaagacgatggggaggaggaggaggat
tgcatccaggttaaggacgaggagggcgagagtggtgctgaggaggggcccgacttggag
gagcctggtgctggatacaaaaaactgttctcagatgcccagccgctgcagcctttgcag
gtgtaccaggcgcccctcagcctggccactgtgccccaccaggccctgggccgtacccag
tcctcccctgctgcccctgggggcatgaagagccccccagaccagcccgtcaagcacctc
ttcaccacaggtgtggtctacgacacgttcatgctaaagcaccagtgcatgtgcgggaac
acacacgtgcaccctgagcatgctggccggatccagagcatctggtcccggctgcaggag
acaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagccacgctagatgagatc
cagacagtgcactctgaataccacaccctgctctatgggaccagtcccctcaaccggcag
aagctagacagcaagaagttgctcggccccatcagccagaagatgtatgctgtgctgcct
tgtgggggcatcggggtggacagtgacaccgtgtggaatgagatgcactcctccagtgct
gtgcgcatggcagtgggctgcctgctggagctggccttcaaggtggctgcaggagagctc
aagaatggatttgccatcatccggcccccaggacaccacgccgaggaatccacagccatg
ggattctgcttcttcaactctgtagccatcaccgcaaaactcctacagcagaagttgaac
gtgggcaaggtcctcatcgtggactgggacattcaccatggcaatggcacccagcaggcg
ttctacaatgacccctctgtgctctacatctctctgcatcgctatgacaacgggaacttc
tttccaggctctggggctcctgaagaggttggtggaggaccaggcgtggggtacaatgtg
aacgtggcatggacaggaggtgtggacccccccattggagacgtggagtaccttacagcc
ttcaggacagtggtgatgcccattgcccacgagttctcacctgatgtggtcctagtctcc
gccgggtttgatgctgttgaaggacatctgtctcctctgggtggctactctgtcaccgcc
agatgttttggccacttgaccaggcagctgatgaccctggcagggggccgggtggtgctg
gccctggagggaggccatgacttgaccgccatctgtgatgcctctgaggcttgtgtctcg
gctctgctcagtgtagagctgcagcccttggatgaggcagtcttgcagcaaaagcccaac
atcaacgcagtggccacgctagagaaagtcatcgagatccagagcaaacactggagctgt
gtgcagaagttcgccgctggtctgggccggtccctgcgagaggcccaagcaggtgagacc
gaggaggccgagactgtgagcgccatggccttgctgtcggtgggggccgagcaggcccag
gctgcggcagcccgggaacacagccccaggccggcagaggagcccatggagcaggagcct
gccctgtga

DBGET integrated database retrieval system