KEGG   Homo sapiens (human): 10014Help
Entry
10014             CDS       T01001                                 

Gene name
HDAC5, HD5, NY-CO-9
Definition
(RefSeq) histone deacetylase 5
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Drug target
Belinostat: D08870
Entinostat: D09338
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    10014 (HDAC5)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10014 (HDAC5)
  Substance dependence
   05034 Alcoholism
    10014 (HDAC5)
  Infectious diseases
   05169 Epstein-Barr virus infection
    10014 (HDAC5)
   05165 Human papillomavirus infection
    10014 (HDAC5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     10014 (HDAC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     10014 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 10014
NCBI-ProteinID: NP_005465
OMIM: 605315
HGNC: 14068
Ensembl: ENSG00000108840
Vega: OTTHUMG00000181806
Pharos: Q9UQL6(Tclin)
UniProt: Q9UQL6
Position
17q21.31
AA seq 1122 aa AA seqDB search
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggatgggatgtcaggtcgggaaccatccttggaaatcctg
ccgcggacttctctgcacagcatccctgtgacagtggaggtgaagccggtgctgccaaga
gccatgcccagttccatggggggtgggggtggaggcagccccagccctgtggagctacgg
ggggctctggtgggctctgtggaccccacactgcgggagcagcaactgcagcaggagctc
ctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccagaaa
cagcatgaccacctgacaaggcagcatgaggtccagctgcagaagcacctcaagcagcag
caggagatgctggcagccaagcagcagcaggagatgctggcagccaagcggcagcaggag
ctggagcagcagcggcagcgggagcagcagcggcaggaagagctggagaagcagcggctg
gagcagcagctgctcatcctgcggaacaaggagaagagcaaagagagtgccattgccagc
actgaggtaaagctgaggctccaggaattcctcttgtcgaagtcaaaggagcccacacca
ggcggcctcaaccattccctcccacagcaccccaaatgctggggagcccaccatgcttct
ttggaccagagttcccctccccagagcggcccccctgggacgcctccctcctacaaactg
cctttgcctgggccctacgacagtcgagacgacttccccctccgcaaaacagcctctgaa
cccaacttgaaagtgcgttcaaggctaaaacagaaggtggctgagcggagaagcagtccc
ctcctgcgtcgcaaggatgggactgttattagcacctttaagaagagagctgttgagatc
acaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcacccggctccggccccagc
tctcccaacagctcccacagcaccatcgctgagaatggctttactggctcagtccccaac
atccccactgagatgctccctcagcaccgagccctccctctggacagctcccccaaccag
ttcagcctctacacgtctccttctctgcccaacatctccctagggctgcaggccacggtc
actgtcaccaactcacacctcactgcctccccgaagctgtcgacacagcaggaggccgag
aggcaggccctccagtccctgcggcagggtggcacgctgaccggcaagttcatgagcaca
tcctctattcctggctgcctgctgggcgtggcactggagggcgacgggagcccccacggg
catgcctccctgctgcagcatgtgctgttgctggagcaggcccggcagcagagcaccctc
attgctgtgccactccacgggcagtccccactagtgacgggtgaacgtgtggccaccagc
atgcggacggtaggcaagctcccgcggcatcggcccctgagccgcactcagtcctcaccg
ctgccgcagagtccccaggccctgcagcagctggtcatgcaacaacagcaccagcagttc
ctggagaagcagaagcagcagcagctacagctgggcaagatcctcaccaagacaggggag
ctgcccaggcagcccaccacccaccctgaggagacagaggaggagctgacggagcagcag
gaggtcttgctgggggagggagccctgaccatgccccgggagggctccacagagagtgag
agcacacaggaagacctggaggaggaggacgaggaagacgatggggaggaggaggaggat
tgcatccaggttaaggacgaggagggcgagagtggtgctgaggaggggcccgacttggag
gagcctggtgctggatacaaaaaactgttctcagatgcccagccgctgcagcctttgcag
gtgtaccaggcgcccctcagcctggccactgtgccccaccaggccctgggccgtacccag
tcctcccctgctgcccctgggggcatgaagagccccccagaccagcccgtcaagcacctc
ttcaccacaggtgtggtctacgacacgttcatgctaaagcaccagtgcatgtgcgggaac
acacacgtgcaccctgagcatgctggccggatccagagcatctggtcccggctgcaggag
acaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagccacgctagatgagatc
cagacagtgcactctgaataccacaccctgctctatgggaccagtcccctcaaccggcag
aagctagacagcaagaagttgctcggccccatcagccagaagatgtatgctgtgctgcct
tgtgggggcatcggggtggacagtgacaccgtgtggaatgagatgcactcctccagtgct
gtgcgcatggcagtgggctgcctgctggagctggccttcaaggtggctgcaggagagctc
aagaatggatttgccatcatccggcccccaggacaccacgccgaggaatccacagccatg
ggattctgcttcttcaactctgtagccatcaccgcaaaactcctacagcagaagttgaac
gtgggcaaggtcctcatcgtggactgggacattcaccatggcaatggcacccagcaggcg
ttctacaatgacccctctgtgctctacatctctctgcatcgctatgacaacgggaacttc
tttccaggctctggggctcctgaagaggttggtggaggaccaggcgtggggtacaatgtg
aacgtggcatggacaggaggtgtggacccccccattggagacgtggagtaccttacagcc
ttcaggacagtggtgatgcccattgcccacgagttctcacctgatgtggtcctagtctcc
gccgggtttgatgctgttgaaggacatctgtctcctctgggtggctactctgtcaccgcc
agatgttttggccacttgaccaggcagctgatgaccctggcagggggccgggtggtgctg
gccctggagggaggccatgacttgaccgccatctgtgatgcctctgaggcttgtgtctcg
gctctgctcagtgtagagctgcagcccttggatgaggcagtcttgcagcaaaagcccaac
atcaacgcagtggccacgctagagaaagtcatcgagatccagagcaaacactggagctgt
gtgcagaagttcgccgctggtctgggccggtccctgcgagaggcccaagcaggtgagacc
gaggaggccgagactgtgagcgccatggccttgctgtcggtgggggccgagcaggcccag
gctgcggcagcccgggaacacagccccaggccggcagaggagcccatggagcaggagcct
gccctgtga

DBGET integrated database retrieval system