KEGG   Homo sapiens (human): 100293534Help
Entry
100293534         CDS       T01001                                 

Gene name
C4B_2
Definition
(RefSeq) complement component 4B (Chido blood group), copy 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TED_complement A2M_recep A2M A2M_BRD NTR MG3 MG2 ANATO MG4 Big_1 Prenyltrans
Motif
Other DBs
NCBI-GeneID: 100293534
NCBI-ProteinID: NP_001229752
HGNC: 42398
UniProt: P0C0L5
Structure
PDB: 

Position
6
AA seq 1744 aa AA seqDB search
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIEYPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYAL
TLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctctgggggctgatctgggcatccagcttcttcaccttatctctgcagaag
cccaggttgctcttgttctctccttctgtggttcatctgggggtccccctatcggtgggg
gtgcagctccaggatgtgccccgaggacaggtagtgaaaggatcagtgttcctgagaaac
ccatctcgtaataatgtcccctgctccccaaaggtggacttcacccttagctcagaaaga
gacttcgcactcctcagtctccaggtgcccttgaaagatgcgaagagctgtggcctccat
caactcctcagaggccctgaggtccagctggtggcccattcgccatggctaaaggactct
ctgtccagaacgacaaacatccagggtatcaacctgctcttctcctctcgccgggggcac
ctctttttgcagacggaccagcccatttacaaccctggccagcgggttcggtaccgggtc
tttgctctggatcagaagatgcgcccgagcactgacaccatcacagtcatggtggagaac
tctcacggcctccgcgtgcggaagaaggaggtgtacatgccctcgtccatcttccaggat
gactttgtgatcccagacatctcagagccagggacctggaagatctcagcccgattctca
gatggcctggaatccaacagcagcacccagtttgaggtgaagaaatatgtccttcccaac
tttgaggtgaagatcacccctggaaagccctacatcctgacggtgccaggccatcttgat
gaaatgcagttagacatccaggccaggtacatctatgggaagccagtgcagggggtggca
tatgtgcgctttgggctcctagatgaggatggtaagaagactttctttcgggggctggag
agtcagaccaagctggtgaatggacagagccacatttccctctcaaaggcagagttccag
gacgccctggagaagctgaatatgggcattactgacctccaggggctgcgcctctacgtt
gctgcagccatcattgagtatccaggtggggagatggaggaggcagagctcacatcctgg
tattttgtgtcatctcccttctccttggatcttagcaagaccaagcgacaccttgtgcct
ggggcccccttcctgctgcaggccttggtccgtgagatgtcaggctccccagcttctggc
attcctgtcaaagtttctgccacggtgtcttctcctgggtctgttcctgaagtccaggac
attcagcaaaacacagacgggagcggccaagtcagcattccaataattatccctcagacc
atctcagagctgcagctctcagtatctgcaggctccccacatccagcgatagccaggctc
actgtggcagccccaccttcaggaggccccgggtttctgtctattgagcggccggattct
cgacctcctcgtgttggggacactctgaacctgaacttgcgagccgtgggcagtggggcc
accttttctcattactactacatgatcctatcccgagggcagatcgtgttcatgaatcga
gagcccaagaggaccctgacctcggtctcggtgtttgtggaccatcacctggcaccctcc
ttctactttgtggccttctactaccatggagaccacccagtggccaactccctgcgagtg
gatgtccaggctggggcctgcgagggcaagctggagctcagcgtggacggtgccaagcag
taccggaacggggagtccgtgaagctccacttagaaaccgactccctagccctggtggcg
ctgggagccttggacacagctctgtatgctgcaggcagcaagtcccacaagcccctcaac
atgggcaaggtctttgaagctatgaacagctatgacctcggctgtggtcctgggggtggg
gacagtgcccttcaggtgttccaggcagcgggcctggccttttctgatggagaccagtgg
accttatccagaaagagactaagctgtcccaaggagaagacaacccggaaaaagagaaac
gtgaacttccaaaaggcgattaatgagaaattgggtcagtatgcttccccgacagccaag
cgctgctgccaggatggggtgacacgtctgcccatgatgcgttcctgcgagcagcgggca
gcccgcgtgcagcagccggactgccgggagcccttcctgtcctgctgccaatttgctgag
agtctgcgcaagaagagcagggacaagggccaggcgggcctccaacgagccctggagatc
ctgcaggaggaggacctgattgatgaggatgacattcccgtgcgcagcttcttcccagag
aactggctctggagagtggaaacagtggaccgctttcaaatattgacactgtggctcccc
gactctctgaccacgtgggagatccatggcctgagcctgtccaaaaccaaaggcctatgt
gtggccaccccagtccagctccgggtgttccgcgagttccacctgcacctccgcctgccc
atgtctgtccgccgctttgagcagctggagctgcggcctgtcctctataactacctggat
aaaaacctgactgtgagcgtccacgtgtccccagtggaggggctgtgcctggctgggggc
ggagggctggcccagcaggtgctggtgcctgcgggctctgcccggcctgttgccttctct
gtggtgcccacggcagccgccgctgtgtctctgaaggtggtggctcgagggtccttcgaa
ttccctgtgggagatgcggtgtccaaggttctgcagattgagaaggaaggggccatccat
agagaggagctggtctatgaactcaaccccttggaccaccgaggccggaccttggaaata
cctggcaactctgatcccaatatgatccctgatggggactttaacagctacgtcagggtt
acagcctcagatccattggacactttaggctctgagggggccttgtcaccaggaggcgtg
gcctccctcttgaggcttcctcgaggctgtggggagcaaaccatgatctacttggctccg
acactggctgcttcccgctacctggacaagacagagcagtggagcacactgcctcccgag
accaaggaccacgccgtggatctgatccagaaaggctacatgcggatccagcagtttcgg
aaggcggatggttcctatgcggcttggttgtcacggggcagcagcacctggctcacagcc
tttgtgttgaaggtcctgagtttggcccaggagcaggtaggaggctcgcctgagaaactg
caggagacatctaactggcttctgtcccagcagcaggctgacggctcgttccaggacctc
tctccagtgatacataggagcatgcaggggggtttggtgggcaatgatgagactgtggca
ctcacagcctttgtgaccatcgcccttcatcatgggctggccgtcttccaggatgagggt
gcagagccattgaagcagagagtggaagcctccatctcaaaggcaagctcatttttgggg
gagaaagcaagtgctgggctcctgggtgcccacgcagctgccatcacggcctatgccctg
acactgaccaaggcccctgcggacctgcggggtgttgcccacaacaacctcatggcaatg
gcccaggagactggagataacctgtactggggctcagtcactggttctcagagcaatgcc
gtgtcgcccaccccagctcctcgcaacccatccgaccccatgccccaggccccagccctg
tggattgaaaccacagcctacgccctgctgcacctcctgcttcacgagggcaaagcagag
atggcagaccaggctgcggcctggctcacccgtcagggcagcttccaagggggattccgc
agtacccaagacacggtgattgccctggatgccctgtctgcctactggattgcctcccac
accactgaggagaggggtctcaatgtgactctcagctccacaggccggaatgggttcaag
tcccacgcgctgcagctgaacaaccgccagattcgcggcctggaggaggagctgcagttt
tccttgggcagcaagatcaatgtgaaggtgggaggaaacagcaaaggaaccctgaaggtc
cttcgtacctacaatgtcctggacatgaagaacacgacctgccaggacctacagatagaa
gtgacagtcaaaggccacgtcgagtacacgatggaagcaaacgaggactatgaggactat
gagtacgatgagcttccagccaaggatgacccagatgcccctctgcagcccgtgacaccc
ctgcagctgtttgagggtcggaggaaccgccgcaggagggaggcgcccaaggtggtggag
gagcaggagtccagggtgcactacaccgtgtgcatctggcggaacggcaaggtggggctg
tctggcatggccatcgcggacgtcaccctcctgagtggattccacgccctgcgtgctgac
ctggagaagctgacctccctctctgaccgttacgtgagtcactttgagaccgaggggccc
cacgtcctgctgtattttgactcggtccccacctcccgggagtgcgtgggctttgaggct
gtgcaggaagtgccggtggggctggtgcagccggccagcgcaaccctgtacgactactac
aaccccgagcgcagatgttctgtgttttacggggcaccaagtaagagcagactcttggcc
accttgtgttctgctgaagtctgccagtgtgctgaggggaagtgccctcgccagcgtcgc
gccctggagcggggtctgcaggacgaggatggctacaggatgaagtttgcctgctactac
ccccgtgtggagtacggcttccaggttaaggttctccgagaagacagcagagctgctttc
cgcctctttgagaccaagatcacccaagtcctgcacttcaccaaggatgtcaaggccgct
gctaatcagatgcgcaacttcctggttcgagcctcctgccgccttcgcttggaacctggg
aaagaatatttgatcatgggtctagatggggccacctatgacctcgagggacacccccag
tacctgctggactcgaatagctggatcgaggagatgccctctgaacgcctgtgccggagc
acccgccagcgggcagcctgtgcccagctcaacgacttcctccaggagtatggcactcag
gggtgccaggtgtga

DBGET integrated database retrieval system