KEGG   Homo sapiens (human): 100528032
Entry
100528032         CDS       T01001                                 

Symbol
KLRC4-KLRK1
Name
(RefSeq) KLRC4-KLRK1 readthrough
  KO
K06728  killer cell lectin-like receptor subfamily K member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100528032 (KLRC4-KLRK1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100528032 (KLRC4-KLRK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    100528032 (KLRC4-KLRK1)
   04091 Lectins [BR:hsa04091]
    100528032 (KLRC4-KLRK1)
CD molecules [BR:hsa04090]
 Proteins
  100528032 (KLRC4-KLRK1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   100528032 (KLRC4-KLRK1)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 100528032
NCBI-ProteinID: NP_001186734
HGNC: 48357
UniProt: P26718 A0A024RAP8
Structure
PDB: 
4PDC 4S0U 1MPU 1KCG 1HYR

Position
12p13.2
AA seq 216 aa
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
NT seq 651 nt   +upstreamnt  +downstreamnt
atggggtggattcgtggtcggaggtctcgacacagctgggagatgagtgaatttcataat
tataacttggatctgaagaagagtgatttttcaacacgatggcaaaagcaaagatgtcca
gtagtcaaaagcaaatgtagagaaaatgcatctccattttttttctgctgcttcatcgct
gtagccatgggaatccgtttcattattatggtaacaatatggagtgctgtattcctaaac
tcattattcaaccaagaagttcaaattcccttgaccgaaagttactgtggcccatgtcct
aaaaactggatatgttacaaaaataactgctaccaattttttgatgagagtaaaaactgg
tatgagagccaggcttcttgtatgtctcaaaatgccagccttctgaaagtatacagcaaa
gaggaccaggatttacttaaactggtgaagtcatatcattggatgggactagtacacatt
ccaacaaatggatcttggcagtgggaagatggctccattctctcacccaacctactaaca
ataattgaaatgcagaagggagactgtgcactctatgcctcgagctttaaaggctatata
gaaaactgttcaactccaaatacgtacatctgcatgcaaaggactgtgtaa

KEGG   Homo sapiens (human): 22914
Entry
22914             CDS       T01001                                 

Symbol
KLRK1, CD314, D12S2489E, KLR, NKG2-D, NKG2D
Name
(RefSeq) killer cell lectin like receptor K1
  KO
K06728  killer cell lectin-like receptor subfamily K member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05144  Malaria
Drug target
Tesnatilimab: D12179
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22914 (KLRK1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    22914 (KLRK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    22914 (KLRK1)
   04091 Lectins [BR:hsa04091]
    22914 (KLRK1)
CD molecules [BR:hsa04090]
 Proteins
  22914 (KLRK1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   22914 (KLRK1)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 22914
NCBI-ProteinID: NP_031386
OMIM: 611817
HGNC: 18788
Ensembl: ENSG00000213809
Vega: OTTHUMG00000168574
Pharos: P26718(Tbio)
UniProt: P26718 A0A024RAP8
Structure
PDB: 
4PDC 4S0U 1MPU 1KCG 1HYR

Position
12p13.2
AA seq 216 aa
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
NT seq 651 nt   +upstreamnt  +downstreamnt
atggggtggattcgtggtcggaggtctcgacacagctgggagatgagtgaatttcataat
tataacttggatctgaagaagagtgatttttcaacacgatggcaaaagcaaagatgtcca
gtagtcaaaagcaaatgtagagaaaatgcatctccattttttttctgctgcttcatcgct
gtagccatgggaatccgtttcattattatggtaacaatatggagtgctgtattcctaaac
tcattattcaaccaagaagttcaaattcccttgaccgaaagttactgtggcccatgtcct
aaaaactggatatgttacaaaaataactgctaccaattttttgatgagagtaaaaactgg
tatgagagccaggcttcttgtatgtctcaaaatgccagccttctgaaagtatacagcaaa
gaggaccaggatttacttaaactggtgaagtcatatcattggatgggactagtacacatt
ccaacaaatggatcttggcagtgggaagatggctccattctctcacccaacctactaaca
ataattgaaatgcagaagggagactgtgcactctatgcctcgagctttaaaggctatata
gaaaactgttcaactccaaatacgtacatctgcatgcaaaggactgtgtaa

DBGET integrated database retrieval system