KEGG   Homo sapiens (human): 100528032
Entry
100528032         CDS       T01001                                 

Gene name
KLRC4-KLRK1
Definition
(RefSeq) KLRC4-KLRK1 readthrough
  KO
K06728  killer cell lectin-like receptor subfamily K member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100528032 (KLRC4-KLRK1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100528032 (KLRC4-KLRK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    100528032 (KLRC4-KLRK1)
   04091 Lectins [BR:hsa04091]
    100528032 (KLRC4-KLRK1)
CD molecules [BR:hsa04090]
 Proteins
  100528032 (KLRC4-KLRK1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   100528032 (KLRC4-KLRK1)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 100528032
NCBI-ProteinID: NP_001186734
HGNC: 48357
UniProt: P26718 A0A024RAP8
Structure
PDB: 
4PDC 4S0U 1MPU 1KCG 1HYR

Position
12p13.2
AA seq 216 aa
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
NT seq 651 nt   +upstreamnt  +downstreamnt
atggggtggattcgtggtcggaggtctcgacacagctgggagatgagtgaatttcataat
tataacttggatctgaagaagagtgatttttcaacacgatggcaaaagcaaagatgtcca
gtagtcaaaagcaaatgtagagaaaatgcatctccattttttttctgctgcttcatcgct
gtagccatgggaatccgtttcattattatggtaacaatatggagtgctgtattcctaaac
tcattattcaaccaagaagttcaaattcccttgaccgaaagttactgtggcccatgtcct
aaaaactggatatgttacaaaaataactgctaccaattttttgatgagagtaaaaactgg
tatgagagccaggcttcttgtatgtctcaaaatgccagccttctgaaagtatacagcaaa
gaggaccaggatttacttaaactggtgaagtcatatcattggatgggactagtacacatt
ccaacaaatggatcttggcagtgggaagatggctccattctctcacccaacctactaaca
ataattgaaatgcagaagggagactgtgcactctatgcctcgagctttaaaggctatata
gaaaactgttcaactccaaatacgtacatctgcatgcaaaggactgtgtaa

KEGG   Homo sapiens (human): 22914
Entry
22914             CDS       T01001                                 

Gene name
KLRK1, CD314, D12S2489E, KLR, NKG2-D, NKG2D
Definition
(RefSeq) killer cell lectin like receptor K1
  KO
K06728  killer cell lectin-like receptor subfamily K member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    22914 (KLRK1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    22914 (KLRK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    22914 (KLRK1)
   04091 Lectins [BR:hsa04091]
    22914 (KLRK1)
CD molecules [BR:hsa04090]
 Proteins
  22914 (KLRK1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   22914 (KLRK1)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 22914
NCBI-ProteinID: NP_031386
OMIM: 611817
HGNC: 18788
Ensembl: ENSG00000213809
Vega: OTTHUMG00000168574
Pharos: P26718(Tbio)
UniProt: P26718 A0A024RAP8
Structure
PDB: 
4PDC 4S0U 1MPU 1KCG 1HYR

Position
12p13.2
AA seq 216 aa
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIA
VAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNW
YESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLT
IIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
NT seq 651 nt   +upstreamnt  +downstreamnt
atggggtggattcgtggtcggaggtctcgacacagctgggagatgagtgaatttcataat
tataacttggatctgaagaagagtgatttttcaacacgatggcaaaagcaaagatgtcca
gtagtcaaaagcaaatgtagagaaaatgcatctccattttttttctgctgcttcatcgct
gtagccatgggaatccgtttcattattatggtaacaatatggagtgctgtattcctaaac
tcattattcaaccaagaagttcaaattcccttgaccgaaagttactgtggcccatgtcct
aaaaactggatatgttacaaaaataactgctaccaattttttgatgagagtaaaaactgg
tatgagagccaggcttcttgtatgtctcaaaatgccagccttctgaaagtatacagcaaa
gaggaccaggatttacttaaactggtgaagtcatatcattggatgggactagtacacatt
ccaacaaatggatcttggcagtgggaagatggctccattctctcacccaacctactaaca
ataattgaaatgcagaagggagactgtgcactctatgcctcgagctttaaaggctatata
gaaaactgttcaactccaaatacgtacatctgcatgcaaaggactgtgtaa

KEGG   Homo sapiens (human): 3820
Entry
3820              CDS       T01001                                 

Gene name
KLRB1, CD161, CLEC5B, NKR, NKR-P1, NKR-P1A, NKRP1A, hNKR-P1A
Definition
(RefSeq) killer cell lectin like receptor B1
  KO
K06543  killer cell lectin-like receptor subfamily B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    3820 (KLRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3820 (KLRB1)
   04091 Lectins [BR:hsa04091]
    3820 (KLRB1)
CD molecules [BR:hsa04090]
 Proteins
  3820 (KLRB1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   3820 (KLRB1)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 3820
NCBI-ProteinID: NP_002249
OMIM: 602890
HGNC: 6373
Ensembl: ENSG00000111796
Vega: OTTHUMG00000168581
Pharos: Q12918(Tbio)
UniProt: Q12918
Structure
PDB: 
5MGR 5MGS 5MGT

Position
12p13.31
AA seq 225 aa
MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSV
SVTSLIQKSSIEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLA
DCSTKESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEI
RGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS
NT seq 678 nt   +upstreamnt  +downstreamnt
atggaccaacaagcaatatatgctgagttaaacttacccacagactcaggcccagaaagt
tcttcaccttcatctcttcctcgggatgtctgtcagggttcaccttggcatcaatttgcc
ctgaaacttagctgtgctgggattattctccttgtcttggttgttactgggttgagtgtt
tcagtgacatccttaatacagaaatcatcaatagaaaaatgcagtgtggacattcaacag
agcaggaataaaacaacagagagaccgggtctcttaaactgcccaatatattggcagcaa
ctccgagagaaatgcttgttattttctcacactgtcaacccttggaataacagtctagct
gattgttccaccaaagaatccagcctgctgcttattcgagataaggatgaattgatacac
acacagaacctgatacgtgacaaagcaattctgttttggattggattaaatttttcatta
tcagaaaagaactggaagtggataaacggctcttttttaaattctaatgacttagaaatt
agaggtgatgctaaagaaaacagctgtatttccatctcacagacatctgtgtattctgag
tactgtagtacagaaatcagatggatctgccaaaaagaactaacacctgtgagaaataaa
gtgtatcctgactcttga

DBGET integrated database retrieval system