KEGG   Homo sapiens (human): 100532731Help
Entry
100532731         CDS       T01001                                 

Gene name
COMMD3-BMI1, BMI1, PCGF4, RNF51
Definition
(RefSeq) COMMD3-BMI1 readthrough
  KO
K11459  polycomb group RING finger protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100532731 (COMMD3-BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100532731 (COMMD3-BMI1)
   05206 MicroRNAs in cancer
    100532731 (COMMD3-BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    100532731 (COMMD3-BMI1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     100532731 (COMMD3-BMI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 Prok-RING_4 zf-RING_UBOX zf-C3HC4_4 zf-Nse
Motif
Other DBs
NCBI-GeneID: 100532731
NCBI-ProteinID: NP_001190991
HGNC: 48326
Ensembl: ENSG00000269897
Vega: OTTHUMG00000184031
UniProt: P35226 R4GMX3
Structure
PDB: 

Position
10p12.2
AA seq 469 aa AA seqDB search
MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLK
HCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGRTLI
PHPIQRLVLVAAWNNYRIFYQAEMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHS
FCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDF
YAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEE
VNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRR
NGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPST
PVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcggagtctgtgcagaaaggcttccagatgctggcggatccccgctccttc
gactccaacgccttcacgcttctcctccgggcggcattccagagtctgctggacgcccag
gcggacgaggccgtgttagatcatccagacttgaaacatatcgacccagtggttttaaaa
cattgtcatgcagcagctgcaacttacatactagaggcaggaaagcaccgagctgacaag
tcaactctaagcacttatctagaagactgtaaatttgacagagagcgaatagaactgttt
tgcacggaatatcagaataataagaattccctagaaatcctactgggaagaacactgatt
ccccatcctatccagagattagttttagttgcagcatggaacaattacaggattttttat
caagcagaaatgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatg
tgtgtgctttgtggagggtacttcattgatgccacaaccataatagaatgtctacattcc
ttctgtaaaacgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgat
gtccaagttcacaagaccagaccactactgaatataaggtcagataaaactctccaagat
attgtatacaaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttt
tatgcagctcatccttctgctgatgctgccaatggctctaatgaagatagaggagaggtt
gcagatgaagataagagaattataactgatgatgagataataagcttatccattgaattc
tttgaccagaacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggag
gtgaatgataaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaag
tttctcagaagtaaaatggacatacctaatactttccagattgatgtcatgtatgaggag
gaacctttaaaggattattatacactaatggatattgcctacatttatacctggagaagg
aatggtccacttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagt
caccagagagatggactgacaaatgctggagaactggaaagtgactctgggagtgacaag
gccaacagcccagcaggaggtattccctccacctcttcttgtttgcctagccccagtact
ccagtgcagtctcctcatccacagtttcctcacatttccagtactatgaatggaaccagc
aacagccccagcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagta
aatgggtcatcagcaacttcttctggttga

DBGET integrated database retrieval system