KEGG   Homo sapiens (human): 100532736Help
Entry
100532736         CDS       T01001                                 

Gene name
MINOS1-NBL1, C1orf151-NBL1, DAN, DAND1, NBL1, MICOS10-NBL1
Definition
(RefSeq) MINOS1-NBL1 readthrough
  KO
K19558  neuroblastoma suppressor of tumorigenicity 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100532736 (MINOS1-NBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAN Cys_knot
Motif
Other DBs
NCBI-GeneID: 100532736
NCBI-ProteinID: NP_001191018
HGNC: 48338
Ensembl: ENSG00000158747
Vega: OTTHUMG00000183956
UniProt: P41271
Structure
PDB: 

Position
1p36.13
AA seq 181 aa AA seqDB search
MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACL
GQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSC
QACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcgggtcctggtgggggctgtcctccctgccatgctactggctgccccacca
cccatcaacaagctggcactgttcccagataagagtgcctggtgcgaagccaagaacatc
acccagatcgtgggccacagcggctgtgaggccaagtccatccagaacagggcgtgccta
ggacagtgcttcagctacagcgtccccaacaccttcccacagtccacagagtccctggtt
cactgtgactcctgcatgccagcccagtccatgtgggagattgtgacgctggagtgcccg
ggccacgaggaggtgcccagggtggacaagctggtggagaagatcctgcactgtagctgc
caggcctgcggcaaggagcctagtcacgaggggctgagcgtctatgtgcagggcgaggac
gggccgggatcccagcccggcacccaccctcacccccatccccacccccatcctggcggg
cagacccctgagcccgaggacccccctggggccccccacacagaggaagagggggctgag
gactga

KEGG   Homo sapiens (human): 4681Help
Entry
4681              CDS       T01001                                 

Gene name
NBL1, D1S1733E, DAN, DAND1, NB, NO3
Definition
(RefSeq) NBL1, DAN family BMP antagonist
  KO
K19558  neuroblastoma suppressor of tumorigenicity 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4681 (NBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAN Cys_knot
Motif
Other DBs
NCBI-GeneID: 4681
NCBI-ProteinID: NP_001191013
OMIM: 600613
HGNC: 7650
Ensembl: ENSG00000158747
Vega: OTTHUMG00000002700
Pharos: P41271(Tbio)
UniProt: P41271
Structure
PDB: 

Position
1p36.13
AA seq 181 aa AA seqDB search
MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACL
GQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSC
QACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcgggtcctggtgggggctgtcctccctgccatgctactggctgccccacca
cccatcaacaagctggcactgttcccagataagagtgcctggtgcgaagccaagaacatc
acccagatcgtgggccacagcggctgtgaggccaagtccatccagaacagggcgtgccta
ggacagtgcttcagctacagcgtccccaacaccttcccacagtccacagagtccctggtt
cactgtgactcctgcatgccagcccagtccatgtgggagattgtgacgctggagtgcccg
ggccacgaggaggtgcccagggtggacaagctggtggagaagatcctgcactgtagctgc
caggcctgcggcaaggagcctagtcacgaggggctgagcgtctatgtgcagggcgaggac
gggccgggatcccagcccggcacccaccctcacccccatccccacccccatcctggcggg
cagacccctgagcccgaggacccccctggggccccccacacagaggaagagggggctgag
gactga

DBGET integrated database retrieval system