KEGG   Homo sapiens (human): 10095
Entry
10095             CDS       T01001                                 

Gene name
ARPC1B, ARC41, IMD71, PLTEID, p40-ARC, p41-ARC
Definition
(RefSeq) actin related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04530  Tight junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01079  Shigella IpaC to Actin signaling pathway
N01086  Escherichia EspT to RAC signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
N01094  Escherichia Eae/Tir/TccP to Actin signaling pathway
N01096  Escherichia Map to CDC42 signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10095 (ARPC1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10095 (ARPC1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10095 (ARPC1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10095 (ARPC1B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10095 (ARPC1B)
   05132 Salmonella infection
    10095 (ARPC1B)
   05131 Shigellosis
    10095 (ARPC1B)
   05135 Yersinia infection
    10095 (ARPC1B)
   05100 Bacterial invasion of epithelial cells
    10095 (ARPC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10095 (ARPC1B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10095 (ARPC1B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10095 (ARPC1B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10095 (ARPC1B)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Other DBs
NCBI-GeneID: 10095
NCBI-ProteinID: NP_005711
OMIM: 604223
HGNC: 704
Ensembl: ENSG00000130429
Vega: OTTHUMG00000154552
Pharos: O15143(Tbio)
UniProt: O15143 A4D275
Position
7q22.1
AA seq 372 aa
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDW
APESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
APTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATL
ASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE
RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVK
SLESALKDLKIK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggcctaccacagcttcctggtggagcccatcagctgccacgcctggaacaaggaccgc
acccagattgccatctgccccaacaaccatgaggtgcatatctatgaaaagagcggtgcc
aaatggaccaaggtgcacgagctcaaggagcacaacgggcaggtgacaggcatcgactgg
gcccccgagagtaaccgtattgtgacctgcggcacagaccgcaacgcctacgtgtggacg
ctgaagggccgcacatggaagcccacgctggtcatcctgcggatcaaccgggctgcccgc
tgcgtgcgctgggcccccaacgagaacaagtttgctgtgggcagcggctctcgtgtgatc
tccatctgttatttcgagcaggagaatgactggtgggtttgcaagcacatcaagaagccc
atccgctccaccgtcctcagcctggactggcaccccaacaatgtgctgctggctgccggc
tcctgtgacttcaagtgtcggatcttttcagcctacatcaaggaggtggaggaacggccg
gcacccaccccgtggggctccaagatgccctttggggaactgatgttcgaatccagcagt
agctgcggctgggtacatggcgtctgtttctcagccagcgggagccgcgtggcctgggta
agccacgacagcaccgtctgcctggctgatgccgacaagaagatggccgtcgcgactctg
gcctctgaaacactaccactgctggcgctgaccttcatcacagacaacagcctggtggca
gcgggccacgactgcttcccggtgctgttcacctatgacgccgccgcggggatgctgagc
ttcggcgggcggctggacgttcctaagcagagctcgcagcgtggcttgacggcccgcgag
cgcttccagaacctggacaagaaggcgagctccgagggtggcacggctgcgggcgcgggc
ctagactcgctgcacaagaacagcgtcagccagatctcggtgctcagcggcggcaaggcc
aagtgctcgcagttctgcaccactggcatggatggcggcatgagtatctgggatgtgaag
agcttggagtcagccttgaaggacctcaagatcaaatga

DBGET integrated database retrieval system