KEGG   Homo sapiens (human): 10130
Entry
10130             CDS       T01001                                 

Gene name
PDIA6, ERP5, P5, TXNDC7
Definition
(RefSeq) protein disulfide isomerase family A member 6
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10130 (PDIA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10130 (PDIA6)
   04131 Membrane trafficking [BR:hsa04131]
    10130 (PDIA6)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     10130 (PDIA6)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   10130 (PDIA6)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    10130 (PDIA6)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_6 Thioredoxin_7 OST3_OST6 Thioredoxin_8 Thioredoxin_9
Other DBs
NCBI-GeneID: 10130
NCBI-ProteinID: NP_005733
OMIM: 611099
HGNC: 30168
Ensembl: ENSG00000143870
Vega: OTTHUMG00000090479
Pharos: Q15084(Tbio)
UniProt: Q15084 A0A384NPU5
Structure
PDB: 
4EF0 4GWR 3VWW 3W8J 1X5D

Position
2p25.1
AA seq 440 aa
MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP
VEDDIDLSDVELDDLGKDEL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggctctcctggtgctcggtctggtgagctgtaccttctttctggcagtgaatggtctg
tattcctctagtgatgatgtgatcgaattaactccatcgaatttcaaccgagaagttatt
cagagtgatagtttgtggcttgtagaattctatgctccatggtgtggtcactgtcaaaga
ttaacaccagaatggaagaaagcagcaactgcattaaaagatgttgtcaaagttggtgca
gttgatgcagataagcatcattccctaggaggtcagtatggtgttcagggatttcctacc
attaagatttttggatccaacaaaaacagaccagaagattaccaaggtggcagaactggt
gaagccattgtagatgctgcgctgagtgctctgcgccagctcgtgaaggatcgcctcggg
ggacggagcggaggatacagttctggaaaacaaggcagaagtgatagttcaagtaagaag
gatgtgattgagctgacagacgacagctttgataagaatgttctggacagtgaagatgtt
tggatggttgagttctatgctccttggtgtggacactgcaaaaacctagagccagagtgg
gctgccgcagcttcagaagtaaaagagcagacgaaaggaaaagtgaaactggcagctgtg
gatgctacagtcaatcaggttctggcctcccgatacgggattagaggatttcctacaatc
aagatatttcagaaaggcgagtctcctgtggattatgacggtgggcggacaagatccgac
atcgtgtcccgggcccttgatttgttttctgataacgccccacctcctgagctgcttgag
attatcaacgaggacattgccaagaggacgtgtgaggagcaccagctctgtgttgtggct
gtgctgccccatatccttgatactggagctgcaggcagaaattcttatctggaagttctt
ctgaagttggcagacaaatacaaaaagaaaatgtgggggtggctgtggacagaagctgga
gcccagtctgaacttgagaccgcgttggggattggagggtttgggtaccccgccatggcc
gccatcaatgcacgcaagatgaaatttgctctgctaaaaggctccttcagtgagcaaggc
atcaacgagtttctcagggagctctcttttgggcgtggctccacggcacctgtaggaggc
ggggctttccctaccatcgttgagagagagccttgggacggcagggatggcgagcttccc
gtggaggatgacattgacctcagtgatgtggagcttgatgacttagggaaagatgagttg
tga

DBGET integrated database retrieval system