KEGG   Homo sapiens (human): 10188Help
Entry
10188             CDS       T01001                                 

Gene name
TNK2, ACK, ACK-1, ACK1, p21cdc42Hs
Definition
(RefSeq) tyrosine kinase non receptor 2
  KO
K08886  activated CDC42 kinase 1 [EC:2.7.10.2 2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10188 (TNK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     10188 (TNK2)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10188 (TNK2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  ACK family
   10188 (TNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr GTPase_binding Pkinase Inhibitor_Mig-6 SH3_9 UBA_4 SH3_1 Kinase-like SH3_2 SAM_2
Motif
Other DBs
NCBI-GeneID: 10188
NCBI-ProteinID: NP_005772
OMIM: 606994
HGNC: 19297
Ensembl: ENSG00000061938
Vega: OTTHUMG00000155737
Pharos: Q07912(Tchem)
UniProt: Q07912 B3KXJ4
Structure
PDB: 

Position
3q29
AA seq 1038 aa AA seqDB search
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL
IGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
GYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
RIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKP
GLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLL
DETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEICSINSTLVGAGVP
AGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQECMRQLQA
PAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPP
REPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRA
GPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTP
APAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPAD
KIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNL
EQAGCHLLGSWGPAHHKR
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagaggagggcacaggctggctgctggagctgctgtccgaggtgcagctgcaa
cagtacttcctgcggctccgagatgacctcaacgtcacccgcctgtcccactttgagtac
gtcaagaatgaggacctggagaagatcggcatgggtcggcctggccagcggcggctgtgg
gaggctgtgaagaggaggaaggccttgtgcaaacgcaagtcgtggatgagtaaggtgttc
agtggaaagcgactggaggctgagttcccacctcatcactctcagagcaccttccggaag
acctcgcccgcccctgggggcccagcaggggaggggcccctgcagagcctcacctgcctc
attggggagaaggacctgcgcctcctggagaagctgggtgatggttcctttggcgtggtg
cgcaggggcgagtgggacgcgccctcagggaagacggtgagtgtggctgtgaagtgcctg
aagcccgatgtcctgagccagccagaagccatggacgacttcatccgggaggtcaatgcc
atgcactcgctcgaccaccgaaacctcatccgcctctacggggtggtgctcacgccgccc
atgaagatggtgacagagctggcacctctgggatcgttgttggaccggctacgtaagcac
cagggccacttcctcctggggactctgagccgctacgctgtgcaggtggctgagggcatg
ggctacctggagtccaagcgctttattcaccgtgacctggctgcccgcaatctgctgttg
gctacccgcgacctggtcaagatcggggactttgggctgatgcgagcactacctcagaat
gacgaccattacgtcatgcaggaacatcgcaaggtgcccttcgcctggtgtgcccccgag
agcctgaagacacgcaccttctcccatgccagcgacacctggatgttcggggtgacactg
tgggaaatgttcacctacggccaggagccctggatcggcctcaacggcagtcagatcctg
cataagatcgacaaggagggggagcggctgccccggcccgaggactgtccccaggacatc
tacaacgtcatggtccagtgctgggctcacaagccagaggacagacccacgtttgtggcc
ctgcgggacttcctgctggaggcccagcccacagacatgcgggcccttcaggactttgag
gaaccggacaagctgcacatccagatgaatgatgtcatcaccgtcatcgagggaagggcc
gagaactactggtggcgtggccagaacacacggacgctgtgtgtggggcccttccctcgc
aacgtggtgacctccgtggccggcctgtcggcccaggacatcagccagcccctgcagaac
agcttcatccacacagggcatggcgacagtgacccccgccactgctggggcttcccggac
aggattgacgaactgtatctgggaaaccccatggacccccccgacctcctgagcgtggaa
ctgagcacctcccggcccccccagcatctaggaggggtgaaaaaaccaacctatgaccct
gtgagcgaggaccaagaccccttgtccagcgacttcaagaggctgggcctgcggaagcca
ggcctgccccgagggctgtggctggcgaagccctcggcgcgggtgccgggcaccaaggcc
agccgaggcagcggggctgaggtcacgctcatcgacttcggtgaggagcccgtggtcccg
gccctacggccctgcgcgccctccctggcgcagctggccatggacgcctgctccctgctg
gacgagaccccgcctcagagccccacgcgggcactgccccggcccctgcaccccacgcct
gtggtggactgggacgcacgcccgctgccccccccgcccgcctatgacgacgtggcccag
gatgaggatgactttgagatctgctccatcaacagcaccctcgtgggcgcgggggtccct
gccgggcccagccagggccagaccaactacgcctttgtgcctgagcaggcgcggccgccc
cctcccctggaggacaacctgttcctcccgccccagggtgggggcaagccgcccagctcc
gcacagaccgcagagatcttccaggcgctacagcaggagtgcatgaggcaactgcaggct
ccggccggctccccggccccctctcccagcccggggggtgacgacaagccccaggtgcct
cctcgggtacccatcccccctcggcccacgcgcccacacgtccagctgtctccagccccc
ccgggcgaggaggagaccagccagtggcctggacctgcttcccctccccgggtgcctccg
cgggagcccctgtcccctcaaggctcgaggacacccagccccctggtaccacctggcagc
tccccgctgccaccccggctctcaagctcacctgggaagaccatgcccaccacccagagc
tttgcctcagaccccaagtacgccaccccccaggtgatccaggcccctggcccgcgggct
ggtccctgcatcctgcccatcgtccgggatggcaagaaggtcagcagcacccactattac
ttgctgcccgagcgaccatcctacctggagcgctaccagcgcttcctgcgtgaggcccag
agccccgaggagcctacccccctgcctgtgcctctgctgctgcccccacccagcacccca
gcccccgccgcccccacggccaccgtgcggccgatgccccaggctgccttggaccccaag
gccaacttctccaccaacaacagcaacccaggggcccggccaccacccccgagggccact
gctcggctgccacagaggggctgccctggcgatgggccagaggcgggccggccagcagac
aagatccagatggccatggtgcatggggtgaccacagaggagtgccaggcggccctgcag
tgccacggctggagcgtgcagagggctgcccagtatctgaaggtggagcagctcttcggg
ctgggtctgcggcccagaggggagtgccacaaagtgctggagatgttcgactggaacctg
gagcaggccggctgccaccttctgggctcctggggccctgcccaccacaagcgctga

DBGET integrated database retrieval system