KEGG   Homo sapiens (human): 10290
Entry
10290             CDS       T01001                                 
Symbol
SPEG, APEG-1, APEG1, BPEG, CNM5, MYLK6, SPEGalpha, SPEGbeta
Name
(RefSeq) striated muscle enriched protein kinase
  KO
K08809  striated muscle-specific serine/threonine protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00700  Centronuclear myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    10290 (SPEG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10290 (SPEG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  Trio family [OT]
   10290 (SPEG)
SSDB
Motif
Pfam: I-set Pkinase Ig_3 Ig_2 PK_Tyr_Ser-Thr ig SPEG_u2 V-set Ig_6 fn3 Pkinase_fungal ABC1 Kdo
Other DBs
NCBI-GeneID: 10290
NCBI-ProteinID: NP_005867
OMIM: 615950
HGNC: 16901
Ensembl: ENSG00000072195
Pharos: Q15772(Tbio)
UniProt: Q15772
Structure
Position
2:219434843..219493629
AA seq 3267 aa
MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDV
RLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNERGRASCE
AVLTVLEVGDSETAEDDISDVQGTQRLELRDDGAFSTPTGGSDTLVGTSLDTPPTSVTGT
SEEQVSWWGSGQTVLEQEAGSGGGTRRLPGSPRQAQATGAGPRHLGVEPLVRASRANLVG
ASWGSEDSLSVASDLYGSAFSLYRGRALSIHVSVPQSGLRREEPDLQPQLASEAPRRPAQ
PPPSKSALLPPPSPRVGKRSPPGPPAQPAATPTSPHRRTQEPVLPEDTTTEEKRGKKSKS
SGPSLAGTAESRPQTPLSEASGRLSALGRSPRLVRAGSRILDKLQFFEERRRSLERSDSP
PAPLRPWVPLRKARSLEQPKSERGAPWGTPGASQEELRAPGSVAERRRLFQQKAASLDER
TRQRSPASDLELRFAQELGRIRRSTSREELVRSHESLRATLQRAPSPREPGEPPLFSRPS
TPKTSRAVSPAAAQPPSPSSAEKPGDEPGRPRSRGPAGRTEPGEGPQQEVRRRDQFPLTR
SRAIQECRSPVPPPAADPPEARTKAPPGRKREPPAQAVRFLPWATPGLEGAAVPQTLEKN
RAGPEAEKRLRRGPEEDGPWGPWDRRGARSQGKGRRARPTSPELESSDDSYVSAGEEPLE
APVFEIPLQNVVVAPGADVLLKCIITANPPPQVSWHKDGSALRSEGRLLLRAEGERHTLL
LREARAADAGSYMATATNELGQATCAASLTVRPGGSTSPFSSPITSDEEYLSPPEEFPEP
GETWPRTPTMKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVV
SWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVR
AHPESRSLAVLAPLQDVDVGAGEMALFECLVAGPTDVEVDWLCRGRLLQPALLKCKMHFD
GRKCKLLLTSVHEDDSGVYTCKLSTAKDELTCSARLTVRPSLAPLFTRLLEDVEVLEGRA
ARFDCKISGTPPPVVTWTHFGCPMEESENLRLRQDGGLHSLHIAHVGSEDEGLYAVSAVN
THGQAHCSAQLYVEEPRTAASGPSSKLEKMPSIPEEPEQGELERLSIPDFLRPLQDLEVG
LAKEAMLECQVTGLPYPTISWFHNGHRIQSSDDRRMTQYRDVHRLVFPAVGPQHAGVYKS
VIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTY
TVQHQVLGSDQWTALVTGLREPGWAATGLRKGVQHIFRVLSTTVKSSSKPSPPSEPVQLL
EHGPTLEEAPAMLDKPDIVYVVEGQPASVTVTFNHVEAQVVWRSCRGALLEARAGVYELS
QPDDDQYCLRICRVSRRDMGALTCTARNRHGTQTCSVTLELAEAPRFESIMEDVEVGAGE
TARFAVVVEGKPLPDIMWYKDEVLLTESSHVSFVYEENECSLVVLSTGAQDGGVYTCTAQ
NLAGEVSCKAELAVHSAQTAMEVEGVGEDEDHRGRRLSDFYDIHQEIGRGAFSYLRRIVE
RSSGLEFAAKFIPSQAKPKASARREARLLARLQHDCVLYFHEAFERRRGLVIVTELCTEE
LLERIARKPTVCESEIRAYMRQVLEGIHYLHQSHVLHLDVKPENLLVWDGAAGEQQVRIC
DFGNAQELTPGEPQYCQYGTPEFVAPEIVNQSPVSGVTDIWPVGVVAFLCLTGISPFVGE
NDRTTLMNIRNYNVAFEETTFLSLSREARGFLIKVLVQDRLRPTAEETLEHPWFKTQAKG
AEVSTDHLKLFLSRRRWQRSQISYKCHLVLRPIPELLRAPPERVWVTMPRRPPPSGGLSS
SSDSEEEELEELPSVPRPLQPEFSGSRVSLTDIPTEDEALGTPETGAATPMDWQEQGRAP
SQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGPRELGRGLHKAASVEL
PQRRSPSPGATRLARGGLGEGEYAQRLQALRQRLLRGGPEDGKVSGLRGPLLESLGGRAR
DPRMARAASSEAAPHHQPPLENRGLQKSSSFSQGEAEPRGRHRRAGAPLEIPVARLGARR
LQESPSLSALSEAQPSSPARPSAPKPSTPKSAEPSATTPSDAPQPPAPQPAQDKAPEPRP
EPVRASKPAPPPQALQTLALPLTPYAQIIQSLQLSGHAQGPSQGPAAPPSEPKPHAAVFA
RVASPPPGAPEKRVPSAGGPPVLAEKARVPTVPPRPGSSLSSSIENLESEAVFEAKFKRS
RESPLSLGLRLLSRSRSEERGPFRGAEEEDGIYRPSPAGTPLELVRRPERSRSVQDLRAV
GEPGLVRRLSLSLSQRLRRTPPAQRHPAWEARGGDGESSEGGSSARGSPVLAMRRRLSFT
LERLSSRLQRSGSSEDSGGASGRSTPLFGRLRRATSEGESLRRLGLPHNQLAAQAGATTP
SAESLGSEASATSGSSAPGESRSRLRWGFSRPRKDKGLSPPNLSASVQEELGHQYVRSES
DFPPVFHIKLKDQVLLEGEAATLLCLPAACPAPHISWMKDKKSLRSEPSVIIVSCKDGRQ
LLSIPRAGKRHAGLYECSATNVLGSITSSCTVAVARVPGKLAPPEVPQTYQDTALVLWKP
GDSRAPCTYTLERRVDGESVWHPVSSGIPDCYYNVTHLPVGVTVRFRVACANRAGQGPFS
NSSEKVFVRGTQDSSAVPSAAHQEAPVTSRPARARPPDSPTSLAPPLAPAAPTPPSVTVS
PSSPPTPPSQALSSLKAVGPPPQTPPRRHRGLQAARPAEPTLPSTHVTPSEPKPFVLDTG
TPIPASTPQGVKPVSSSTPVYVVTSFVSAPPAPEPPAPEPPPEPTKVTVQSLSPAKEVVS
SPGSSPRSSPRPEGTTLRQGPPQKPYTFLEEKARGRFGVVRACRENATGRTFVAKIVPYA
AEGKRRVLQEYEVLRTLHHERIMSLHEAYITPRYLVLIAESCGNRELLCGLSDRFRYSED
DVATYMVQLLQGLDYLHGHHVLHLDIKPDNLLLAPDNALKIVDFGSAQPYNPQALRPLGH
RTGTLEFMAPEMVKGEPIGSATDIWGAGVLTYIMLSGRSPFYEPDPQETEARIVGGRFDA
FQLYPNTSQSATLFLRKVLSVHPWSRPSLQDCLAHPWLQDAYLMKLRRQTLTFTTNRLKE
FLGEQRRRRAEAATRHKVLLRSYPGGP
NT seq 9804 nt   +upstreamnt  +downstreamnt
atgcagaaagcccggggcacgcgaggcgaggatgcgggcacgagggcaccccccagcccc
ggagtgcccccgaaaagggccaaggtgggggccggcggcggggctcctgtggccgtggcc
ggggcgccagtcttcctgcggcccctgaagaacgcggcggtgtgcgcgggcagcgacgtg
cggctgcgggtggtggtgagcgggacgccccagcccagcctccgctggttccgggatggg
cagctcctgcccgcgccggcccccgagcccagctgcctgtggctgcggcgctgcggggcg
caggacgccggcgtgtacagctgcatggcccagaacgagcggggccgggcctcctgcgag
gcggtgctcacagtgctggaggtcggagactcagagacggctgaggatgacatcagcgat
gtgcagggaacccagcgcctggagcttcgggatgacggggccttcagcacccccacgggg
ggttctgacaccctggtgggcacctccctggacacacccccgacctccgtgacaggcacc
tcagaggagcaagtgagctggtggggcagcgggcagacggtcctggagcaggaagcgggc
agtgggggtggcacccgccgcctcccgggcagcccaaggcaagcacaggcaaccggggcc
gggccacggcacctgggggtggagccgctggtgcgggcatctcgagctaatctggtgggc
gcaagctgggggtcagaggatagcctttccgtggccagtgacctgtacggcagcgcattc
agcctgtacagaggacgggcgctctctatccacgtcagcgtccctcagagcgggttgcgc
agggaggagcccgaccttcagcctcaactggccagcgaagccccacgccgccctgcccag
ccgcctccttccaaatccgcgctgctccccccaccgtcccctcgggtcgggaagcggtcc
ccgccgggacccccggcccagcccgcggccacccccacgtcgccccaccgtcgcactcag
gagcctgtgctgcccgaggacaccaccaccgaagagaagcgagggaagaagtccaagtcg
tccgggccctccctggcgggcaccgcggaatcccgaccccagacgccactgagcgaggcc
tcaggccgcctgtcggcgttgggccgatcgcctaggctggtgcgcgccggctcccgcatc
ctggacaagctgcagttcttcgaggagcgacggcgcagcctggagcgcagcgactcgccg
ccggcgcccctgcggccctgggtgcccctgcgcaaggcccgctctctggagcagcccaag
tcggagcgcggcgcaccgtggggcacccccggggcctcgcaggaagaactgcgggcgcca
ggcagcgtggccgagcggcgccgcctgttccagcagaaagcggcctcgctggacgagcgc
acgcgtcagcgcagcccggcctcagacctcgagctgcgcttcgcccaggagctgggccgc
atccgccgctccacgtcgcgggaggagctggtgcgctcgcacgagtccctgcgcgccacg
ctgcagcgtgccccatcccctcgagagcccggcgagcccccgctcttctctcggccctcc
acccccaagacatcgcgggccgtgagccccgccgccgcccagccgccctctccgagcagc
gcggagaagccgggggacgagcctgggaggcccaggagccgcgggccggcgggcaggaca
gagccgggggaaggcccgcagcaggaggttaggcgtcgggaccaattcccgctgacccgg
agcagagccatccaggagtgcaggagccctgtgccgccccccgccgccgatcccccagag
gccaggacgaaagcaccccccggtcggaagcgggagcccccggcgcaggccgtgcgcttc
ctgccctgggccacgccgggcctggagggcgctgctgtaccccagaccttggagaagaac
agggcggggcctgaggcagagaagaggcttcgcagagggccggaggaggacggtccctgg
gggccctgggaccgccgaggggcccgcagccagggcaaaggtcgccgggcccggcccacc
tcccctgagctcgagtcttcggatgactcctacgtgtccgctggagaagagcccctagag
gcccctgtgtttgagatccccctgcagaatgtggtggtggcaccaggggcagatgtgctg
ctcaagtgtatcatcactgccaaccccccgccccaagtgtcctggcacaaggatgggtca
gcgctgcgcagcgagggccgcctcctcctccgggctgagggtgagcggcacaccctgctg
ctcagggaggccagggcagcagatgccgggagctatatggccaccgccaccaacgagctg
ggccaggccacctgtgccgcctcactgaccgtgagacccggtgggtctacatcccctttc
agcagccccatcacctccgacgaggaatacctgagccccccagaggagttcccagagcct
ggggagacctggccgcgaacccccaccatgaagcccagtcccagccagaaccgccgttct
tctgacactggctccaaggcaccccccaccttcaaggtctcacttatggaccagtcagta
agagaaggccaagatgtcatcatgagcatccgcgtgcagggggagcccaagcctgtggtc
tcctggctgagaaaccgccagcccgtgcgcccagaccagcggcgctttgcggaggaggct
gagggtgggctgtgccggctgcggatcctggctgcagagcgtggcgatgctggtttctac
acttgcaaagcggtcaatgagtatggtgctcggcagtgcgaggcccgcttggaggtccga
gcacaccctgaaagccggtccctggccgtgctggcccccctgcaggacgtggacgtgggg
gccggggagatggcgctgtttgagtgcctggtggcggggcccactgacgtggaggtggat
tggctgtgccgtggccgcctgctgcagcctgcactgctcaaatgcaagatgcatttcgat
ggccgcaaatgcaagctgctacttacatctgtacatgaggacgacagtggcgtctacacc
tgcaagctcagcacggccaaagatgagctgacctgcagtgcccggctgaccgtgcggccc
tcgttggcacccctgttcacacggctgctggaagatgtggaggtgttggagggccgagct
gcccgtttcgactgcaagatcagtggcaccccgccccctgttgttacctggactcatttt
ggctgccccatggaggagagtgagaacttgcggctgcggcaggacgggggtctgcactca
ctgcacattgcccatgtgggcagcgaggacgaggggctctatgcggtcagtgctgttaac
acccatggccaggcccactgctcagcccagctgtatgtagaagagccccggacagccgcc
tcaggccccagctcgaagctggagaagatgccatccattcccgaggagccagagcagggt
gagctggagcggctgtccattcctgacttcctgcggccactgcaggacctggaggtggga
ctggccaaggaggccatgctagagtgccaggtgaccggcctgccctaccccaccatcagc
tggttccacaatggccaccgcatccagagcagcgacgaccggcgcatgacacagtacagg
gatgtccatcgcttggtgttccctgccgtggggcctcagcacgccggtgtctacaagagc
gtcattgccaacaagctgggcaaagctgcctgctatgcccacctgtatgtcacagatgtg
gtcccaggccctccagatggcgccccgcaggtggtggctgtgacggggaggatggtcaca
ctcacatggaacccccccaggagtctggacatggccatcgacccggactccctgacgtac
acagtgcagcaccaggtgctgggctcggaccagtggacggcactggtcacaggcctgcgg
gagccagggtgggcagccacagggctgcgtaagggggtccagcacatcttccgggtcctc
agcaccactgtcaagagcagcagcaagccctcacccccttctgagcctgtgcagctgctg
gagcacggcccaaccctggaggaggcccctgccatgctggacaaaccagacatcgtgtat
gtggtggagggacagcctgccagcgtcaccgtcacattcaaccatgtggaggcccaggtc
gtctggaggagctgccgaggggccctcctagaggcacgggccggtgtgtacgagctgagc
cagccagatgatgaccagtactgtcttcggatctgccgggtgagccgccgggacatgggg
gccctcacctgcaccgcccgaaaccgtcacggcacacagacctgctcggtcacattggag
ctggcagaggcccctcggtttgagtccatcatggaggacgtggaggtgggggctggggaa
actgctcgctttgcggtggtggtcgagggaaaaccactgccggacatcatgtggtacaag
gacgaggtgctgctgaccgagagcagccatgtgagcttcgtgtacgaggagaatgagtgc
tccctggtggtgctcagcacgggggcccaggatggaggcgtctacacctgcaccgcccag
aacctggcgggtgaggtctcctgcaaagcagagttggctgtgcattcagctcagacagct
atggaggtcgagggggtcggggaggatgaggaccatcgaggaaggagactcagcgacttt
tatgacatccaccaggagatcggcaggggtgctttctcctacttgcggcgcatagtggag
cgtagctccggcctggagtttgcggccaagttcatccccagccaggccaagccaaaggca
tcagcgcgtcgggaggcccggctgctggccaggctccagcacgactgtgtcctctacttc
catgaggccttcgagaggcgccggggactggtcattgtcaccgagctctgcacagaggag
ctgctggagcgaatcgccaggaaacccaccgtgtgtgagtctgagatccgggcctatatg
cggcaggtgctagagggaatacactacctgcaccagagccacgtgctgcacctcgatgtc
aagcctgagaacctgctggtgtgggatggtgctgcgggcgagcagcaggtgcggatctgt
gactttgggaatgcccaggagctgactccaggagagccccagtactgccagtatggcaca
cctgagtttgtagcacccgagattgtcaatcagagccccgtgtctggagtcactgacatc
tggcctgtgggtgttgttgccttcctctgtctgacaggaatctccccgtttgttggggaa
aatgaccggacaacattgatgaacatccgaaactacaacgtggccttcgaggagaccaca
ttcctgagcctgagcagggaggcccggggcttcctcatcaaagtgttggtgcaggaccgg
ctgagacctaccgcagaagagaccctagaacatccttggttcaaaactcaggcaaagggc
gcagaggtgagcacggatcacctgaagctattcctctcccggcggaggtggcagcgctcc
cagatcagctacaaatgccacctggtgctgcgccccatccccgagctgctgcgggccccc
ccagagcgggtgtgggtgaccatgcccagaaggccaccccccagtggggggctctcatcc
tcctcggattctgaagaggaagagctggaagagctgccctcagtgccccgcccactgcag
cccgagttctctggctcccgggtgtccctcacagacattcccactgaggatgaggccctg
gggaccccagagactggggctgccacccccatggactggcaggagcagggaagggctccc
tctcaggaccaggaggctcccagcccagaggccctcccctccccaggccaggagcccgca
gctggggctagccccaggcggggagagctccgcaggggcagctcggctgagagcgccctg
ccccgggccgggccgcgggagctgggccggggcctgcacaaggcggcgtctgtggagctg
ccgcagcgccggagccccagcccgggagccacccgcctggcccggggaggcctgggtgag
ggcgagtatgcccagaggctgcaggccctgcgccagcggctgctgcggggaggccccgag
gatggcaaggtcagcggcctcaggggtcccctgctggagagcctggggggccgtgctcgg
gacccccggatggcacgagctgcctccagcgaggcagcgccccaccaccagcccccactc
gagaaccggggcctgcaaaagagcagcagcttctcccagggtgaggcggagccccggggc
cggcaccgccgagcgggggcgcccctcgagatccccgtggccaggcttggggcccgtagg
ctacaggagtctccttccctgtctgccctcagcgaggcccagccatccagccctgcacgg
cccagcgcccccaaacccagtacccctaagtctgcagaaccttctgccaccacacctagt
gatgctccgcagccccccgcaccccagcctgcccaagacaaggctccagagcccaggcca
gaaccagtccgagcctccaagcctgcaccacccccccaggccctgcaaaccctagcgctg
cccctcacaccctatgctcagatcattcagtccctccagctgtcaggccacgcccagggc
ccctcgcagggccctgccgcgccgccttcagagcccaagccccacgctgctgtctttgcc
agggtggcctccccacctccgggagcccccgagaagcgcgtgccctcagccgggggtccc
ccggtgctagccgagaaagcccgagttcccacggtgccccccaggccaggcagcagtctc
agtagcagcatcgaaaacttggagtcggaggccgtgttcgaggccaagttcaagcgcagc
cgcgagtcgcccctgtcgctggggctgcggctgctgagccgttcgcgctcggaggagcgc
ggccccttccgtggggccgaggaggaggatggcatataccggcccagcccggcggggacc
ccgctggagctggtgcgacggcctgagcgctcacgctcggtgcaggacctcagggctgtc
ggagagcctggcctcgtccgccgcctctcgctgtcactgtcccagcggctgcggcggacc
cctcccgcgcagcgccacccggcctgggaggcccgcggcggggacggagagagctcggag
ggcgggagctcggcgcggggctccccggtgctggcgatgcgcaggcggctgagcttcacc
ctggagcggctgtccagccgattgcagcgcagtggcagcagcgaggactcggggggcgcg
tcgggccgcagcacgccgctgttcggacggcttcgcagggccacgtccgagggcgagagt
ctgcggcgccttggccttccgcacaaccagttggccgcccaggccggcgccaccacgcct
tccgccgagtccctgggctccgaggccagcgccacgtcgggctcctcagccccaggggaa
agccgaagccggctccgctggggcttctctcggccgcggaaggacaaggggttatcgcca
ccaaacctctctgccagcgtccaggaggagttgggtcaccagtacgtgcgcagtgagtca
gacttccccccagtcttccacatcaaactcaaggaccaggtgctgctggagggggaggca
gccaccctgctctgcctgccagcggcctgccctgcaccgcacatctcctggatgaaagac
aagaagtccttgaggtcagagccctcagtgatcatcgtgtcctgcaaagatgggcggcag
ctgctcagcatcccccgggcgggcaagcggcacgccggtctctatgagtgctcggccacc
aacgtactgggcagcatcaccagctcctgtaccgtggctgtggcccgagtcccaggaaag
ctagctcctccagaggtaccccagacctaccaggacacggcgctggtgctgtggaagccg
ggagacagccgggcaccttgcacgtatacgctggagcggcgagtggatggggagtctgtg
tggcaccctgtgagctcaggcatccccgactgttactacaacgtgacccacctgccagtt
ggcgtgactgtgaggttccgtgtggcctgtgccaaccgtgctgggcaggggcccttcagc
aactcttctgagaaggtctttgtcaggggtactcaagattcttcagctgtgccatctgct
gcccaccaagaggcccctgtcacctcaaggccagccagggcccggcctcctgactctcct
acctcactggccccacccctagctcctgctgcccccacacccccgtcagtcactgtcagc
ccctcatctccccccacacctcctagccaggccttgtcctcgctcaaggctgtgggtcca
ccaccccaaacccctccacgaagacacaggggcctgcaggctgcccggccagcggagccc
accctacccagtacccacgtcaccccaagtgagcccaagcctttcgtccttgacactggg
accccgatcccagcctccactcctcaaggggttaaaccagtgtcttcctctactcctgtg
tatgtggtgacttcctttgtgtctgcaccaccagcccctgagcccccagcccctgagccc
cctcctgagcctaccaaggtgactgtgcagagcctcagcccggccaaggaggtggtcagc
tcccctgggagcagtccccgaagctctcccaggcctgagggtaccactcttcgacagggt
ccccctcagaaaccctacaccttcctggaggagaaagccaggggccgctttggtgttgtg
cgagcgtgccgggagaatgccacggggcgaacgttcgtggccaagatcgtgccctatgct
gccgagggcaagcggcgggtcctgcaggagtacgaggtgctgcggaccctgcaccacgag
cggatcatgtccctgcacgaggcctacatcacccctcggtacctcgtgctcattgctgag
agctgtggcaaccgggaactcctctgtgggctcagtgacaggttccggtattctgaggat
gacgtggccacttacatggtgcagctgctacaaggcctggactacctccacggccaccac
gtgctccacctagacatcaagccagacaacctgctgctggcccctgacaatgccctcaag
attgtggactttggcagtgcccagccctacaacccccaggcccttaggccccttggccac
cgcacgggcacgctggagttcatggctccggagatggtgaagggagaacccatcggctct
gccacggacatctggggagcgggtgtgctcacttacattatgctcagtggacgctccccg
ttctatgagccagacccccaggaaacggaggctcggattgtggggggccgctttgatgcc
ttccagctgtaccccaatacatcccagagcgccaccctcttcttgcgaaaggttctctct
gtacatccctggagccggccctccctgcaggactgcctggcccacccatggttgcaggac
gcctacctgatgaagctgcgccgccagacgctcaccttcaccaccaaccggctcaaggag
ttcctgggcgagcagcggcggcgccgggctgaggctgccacccgccacaaggtgctgctg
cgctcctaccctggcggcccctag

DBGET integrated database retrieval system