KEGG   Homo sapiens (human): 1036
Entry
1036              CDS       T01001                                 
Symbol
CDO1, CDO-I
Name
(RefSeq) cysteine dioxygenase type 1
  KO
K00456  cysteine dioxygenase [EC:1.13.11.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00430  Taurine and hypotaurine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    1036 (CDO1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    1036 (CDO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.20  cysteine dioxygenase
     1036 (CDO1)
SSDB
Motif
Pfam: CDO_I PCO_ADO
Other DBs
NCBI-GeneID: 1036
NCBI-ProteinID: NP_001792
OMIM: 603943
HGNC: 1795
Ensembl: ENSG00000129596
Pharos: Q16878(Tbio)
UniProt: Q16878
Structure
Position
5:complement(115804733..115816659)
AA seq 200 aa
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTR
NLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKK
SERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMT
FHSKFGIRTPNATSGSLENN
NT seq 603 nt   +upstreamnt  +downstreamnt
atggaacagaccgaagtgctgaagccacggaccctggctgatctgatccgcatcctgcac
cagctctttgccggcgatgaggtcaatgtagaggaggtgcaggccatcatggaagcctac
gagagcgaccccaccgagtgggcaatgtacgccaagttcgaccagtacaggtatacccga
aatcttgtggatcaaggaaatggaaaatttaatctgatgattctctgttggggtgaagga
catggcagcagtattcatgatcataccaactcccactgctttctgaagatgctacaggga
aatctaaaggagacattatttgcctggcctgacaaaaaatccaatgagatggtcaagaag
tctgaaagagtcttgagggaaaaccagtgtgcctacatcaatgattccattggcttacat
cgagtagagaacatcagccatacggaacctgctgtgagccttcacttgtacagtccacct
tttgatacatgccatgcctttgatcaaagaacaggacataaaaacaaagtcacaatgaca
ttccatagtaaatttggaatcagaactccaaatgcaacttcgggctcgctggagaacaac
taa

DBGET integrated database retrieval system