KEGG   Homo sapiens (human): 10439
Entry
10439             CDS       T01001                                 
Symbol
OLFM1, AMY, NOE1, NOELIN1, OlfA
Name
(RefSeq) olfactomedin 1
  KO
K25444  noelin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    10439 (OLFM1)
SSDB
Motif
Pfam: OLF Noelin-1 EzrA Helo_like_N Myosin_tail_1 ATG17_like BLOC1_2 Baculo_PEP_C Exonuc_VII_L FUSC CENP-Q DUF5917 Laminin_II
Other DBs
NCBI-GeneID: 10439
NCBI-ProteinID: NP_001269540
OMIM: 605366
HGNC: 17187
Ensembl: ENSG00000130558
Pharos: Q99784(Tbio)
UniProt: Q99784
Structure
Position
9:135075505..135121184
AA seq 485 aa
MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESW
QVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQ
YVEKMENQMKGLESKFKQVEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQ
FKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVTVK
TSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSG
TGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVD
ESGLWAVYATNQNAGNIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSG
GTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVI
RSDEL
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcggtgccgctgctcaagatcggggtcgtgctgagcaccatggccatgatcactaac
tggatgtcccagacgctgccctcgctggtgggcctcaacaccaccaagctctcggcggcc
ggcggcgggacgctggaccgcagcaccggcgtgctgcccaccaaccctgaggagagctgg
caggtgtacagctctgcccaggacagcgagggcaggtgtatctgcacagtggtcgctcca
cagcagaccatgtgttcacgggatgcccgcacaaaacagctgaggcagctactggagaag
gtgcagaacatgtctcaatccatagaggtcttggacaggcggacccagagagacttgcag
tacgtggagaagatggagaaccaaatgaaaggactggagtccaagttcaaacaggtggag
gagagtcataagcaacacctggccaggcagtttaaggcgataaaagcgaaaatggatgaa
cttaggcctttgatacctgtgttggaagagtacaaggccgatgccaaattggtattgcag
tttaaagaggaggtccagaatctgacgtcagtgcttaacgagctgcaagaggaaattggc
gcctatgactacgatgaacttcagagcagagtgtccaatcttgaagaaaggctccgtgca
tgcatgcaaaaactagcttgcgggaagttgacgggcatcagtgaccccgtgactgtcaag
acctccggctcgaggttcggatcctggatgacagaccctctcgcccctgaaggcgataac
cgggtgtggtacatggacggctatcacaacaaccgcttcgtacgtgagtacaagtccatg
gttgacttcatgaacacggacaatttcacctcccaccgtctcccccacccctggtcgggc
acggggcaggtggtctacaacggttctatctacttcaacaagttccagagccacatcatc
atcaggtttgacctgaagacagagaccatcctcaagacccgcagcctggactatgccggt
tacaacaacatgtaccactacgcctggggtggccactcggacatcgacctcatggtggac
gagagcgggctgtgggccgtgtacgccaccaaccagaacgctggcaacatcgtggtcagt
aggctggaccccgtgtccctgcagaccctgcagacctggaacacgagctaccccaagcgc
agcgccggggaggccttcatcatctgcggcacgctgtacgtcaccaacggctactcaggg
ggtaccaaggtccactatgcataccagaccaatgcctccacctatgaatacatcgacatc
ccattccagaacaaatactcccacatctccatgctggactacaaccccaaggaccgggcc
ctgtatgcctggaacaacggccaccagatcctctacaacgtgaccctcttccacgtcatc
cgctccgacgagttgtag

DBGET integrated database retrieval system