KEGG   Homo sapiens (human): 10475
Entry
10475             CDS       T01001                                 

Gene name
TRIM38, RNF15, RORET
Definition
(RefSeq) tripartite motif containing 38
  KO
K12014  tripartite motif-containing protein 38 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    10475 (TRIM38)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     10475 (TRIM38)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    10475 (TRIM38)
SSDB
Motif
Pfam: PRY SPRY zf-C3HC4_4 zf-B_box zf-RING_UBOX zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_5 U-box zf-C3HC4_2 zf-RING_6 RDM Trm112p
Other DBs
NCBI-GeneID: 10475
NCBI-ProteinID: NP_006346
HGNC: 10059
Ensembl: ENSG00000112343
Vega: OTTHUMG00000014414
Pharos: O00635(Tbio)
UniProt: O00635 A0A024QZY4
Position
6p22.2
AA seq 465 aa
MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCP
QCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQ
HKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIR
SDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGS
AQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDT
AHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFEVDVGEGTGWD
LGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggcctcaaccaccagcaccaagaagatgatggaggaagccacctgctccatctgcctg
agcctgatgacgaacccagtaagcatcaactgtggacacagctactgccacttgtgtata
acagacttctttaaaaacccaagccaaaagcaactgaggcaggagacattctgctgtccc
cagtgtcgggctccatttcatatggatagcctccgacccaacaagcagctgggaagcctc
attgaagccctcaaagagacggatcaagaaatgtcatgtgaggaacacggagagcagttc
cacctgttctgcgaagacgaggggcagctcatctgctggcgctgtgagcgggcaccacag
cacaaagggcacaccacagctcttgttgaagacgtatgccagggctacaaggaaaagctc
cagaaagctgtgacaaaactgaagcaacttgaagacagatgtacggagcagaagctgtcc
acagcaatgcgaataactaaatggaaagagaaggtacagattcagagacaaaaaatccgg
tctgactttaagaatctccagtgtttcctacatgaggaagagaagtcttatctctggagg
ctggagaaagaagaacaacagactctgagtagactgagggactatgaggctggtctgggg
ctgaagagcaatgaactcaagagccacatcctggaactggaggaaaaatgtcagggctca
gcccagaaattgctgcagaatgtgaatgacactttgagcaggagttgggctgtgaagctg
gaaacatcagaggctgtctccttggaacttcatactatgtgcaatgtttccaagctttac
ttcgatgtgaagaaaatgttaaggagtcatcaagttagtgtgactctggatccagataca
gctcatcacgaactaattctctctgaggatcggagacaagtgactcgtggatacacccag
gagaatcaggacacatcttccaggagatttactgccttcccctgtgtcttgggttgtgaa
ggcttcacctcaggaagacgttactttgaagtggatgttggcgaaggaaccggatgggat
ttaggagtttgtatggaaaatgtgcagaggggcactggcatgaagcaagagcctcagtct
ggattctggaccctcaggctgtgcaaaaagaaaggctatgtagcacttacttctccccca
acttcccttcatctgcatgagcagcccctgcttgtgggaatttttctggactatgaggcc
ggagttgtatccttttataacgggaatactggctgccacatctttactttcccgaaggct
tccttctctgatactctccggccctatttccaggtttatcaatattctcctttgtttctg
cctcccccaggtgactaa

DBGET integrated database retrieval system