KEGG   Homo sapiens (human): 10856
Entry
10856             CDS       T01001                                 

Gene name
RUVBL2, CGI-46, ECP-51, ECP51, INO80J, REPTIN, RVB2, TAP54-beta, TIH2, TIP48, TIP49B
Definition
(RefSeq) RuvB like AAA ATPase 2
  KO
K11338  RuvB-like protein 2 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10856 (RUVBL2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     10856 (RUVBL2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     10856 (RUVBL2)
  Chromatin remodeling factors
   SRCAP complex
    10856 (RUVBL2)
   INO80 complex
    10856 (RUVBL2)
   INO80 complex (yeast)
    10856 (RUVBL2)
   SWR1 complex
    10856 (RUVBL2)
SSDB
Motif
Pfam: TIP49 TIP49_C AAA AAA_16 RuvB_N DnaB_C AAA_5 AAA_22 Sigma54_activat Mg_chelatase AAA_19 AAA_25 ATPase Zeta_toxin DUF2075 NACHT AAA_7 AAA_23 AAA_11 MS_channel PhoH TsaE AAA_28
Other DBs
NCBI-GeneID: 10856
NCBI-ProteinID: NP_006657
OMIM: 604788
HGNC: 10475
Ensembl: ENSG00000183207
Vega: OTTHUMG00000183333
Pharos: Q9Y230(Tbio)
UniProt: Q9Y230
Structure
PDB: 

Position
19q13.33
AA seq 463 aa
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIE
SLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVH
TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDE
VHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTT
PYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcaaccgttacagccacaaccaaagtcccggagatccgtgatgtaacaaggattgag
cgaatcggtgcccactcccacatccggggactggggctggacgatgccttggagcctcgg
caggcttcgcaaggcatggtgggtcagctggcggcacggcgggcggctggcgtggtgctg
gagatgatccgggaagggaagattgccggtcgggcagtccttattgctggccagccgggc
acggggaagacggccatcgccatgggcatggcgcaggccctgggccctgacacgccattc
acagccatcgccggcagtgaaatcttctccctggagatgagcaagaccgaggcgctgacg
caggccttccggcggtccatcggcgttcgcatcaaggaggagacggagatcatcgaaggg
gaggtggtggagatccagattgatcgaccagcaacagggacgggctccaaggtgggcaaa
ctgaccctcaagaccacagagatggagaccatctacgacctgggcaccaagatgattgag
tccctgaccaaggacaaggtccaggccggggacgtgatcaccatcgacaaggcgacgggc
aagatctccaagctgggccgctccttcacacgcgcccgcgactacgacgctatgggctcc
cagaccaagttcgtgcagtgcccagatggggagctccagaaacgcaaggaggtggtgcac
accgtgtccctgcacgagatcgacgtcatcaactctcgcacccagggcttcctggcgctc
ttctcaggtgacacaggggagatcaagtcagaagtccgtgagcagatcaatgccaaggtg
gctgagtggcgcgaggagggcaaggcggagatcatccctggagtgctgttcatcgacgag
gtccacatgctggacatcgagagcttctccttcctcaaccgggccctggagagtgacatg
gcgcctgtcctgatcatggccaccaaccgtggcatcacgcgaatccggggcaccagctac
cagagccctcacggcatccccatagacctgctggaccggctgcttatcgtctccaccacc
ccctacagcgagaaagacacgaagcagatcctccgcatccggtgcgaggaagaagatgtg
gagatgagtgaggacgcctacacggtgctgacccgcatcgggctggagacgtcactgcgc
tacgccatccagctcatcacagctgccagcttggtgtgccggaaacgcaagggtacagaa
gtgcaggtggatgacatcaagcgggtctactcactcttcctggacgagtcccgctccacg
cagtacatgaaggagtaccaggacgccttcctcttcaacgaactcaaaggcgagaccatg
gacacctcctga

DBGET integrated database retrieval system