KEGG   Homo sapiens (human): 11059Help
Entry
11059             CDS       T01001                                 

Gene name
WWP1, AIP5, Tiul1, hSDRP1
Definition
(RefSeq) WW domain containing E3 ubiquitin protein ligase 1
  KO
K05633  NEDD4-like E3 ubiquitin-protein ligase WWP1 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11059 (WWP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11059 (WWP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11059 (WWP1)
   04121 Ubiquitin system [BR:hsa04121]
    11059 (WWP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     11059 (WWP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    11059 (WWP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   11059 (WWP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW C2
Motif
Other DBs
NCBI-GeneID: 11059
NCBI-ProteinID: NP_008944
OMIM: 602307
HGNC: 17004
Ensembl: ENSG00000123124
Vega: OTTHUMG00000163690
Pharos: Q9H0M0(Tbio)
UniProt: Q9H0M0
Structure
PDB: 

Position
8q21.3
AA seq 922 aa AA seqDB search
MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEITKTAKSSSSS
NPKWDEQLTVNVTPQTTLEFQVWSHRTLKADALLGKATIDLKQALLIHNRKLERVKEQLK
LSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQENGDALHENGEPSARTTAR
LAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADD
TVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTS
AELESEARSILEPDTSNSRSSSAFEAAKSRQPDGCMDPVRQQSGNANTETLPSGWEQRKD
PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRRRVYYVDHNTRTTTWQRPTMESVRNF
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
IAYERGFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
SYEQLKEKLLFAIEETEGFGQE
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcttcaccaaggtctgatactagtaataaccacagtggaaggttgcagtta
caggtaactgtttctagtgccaaacttaaaagaaaaaagaactggttcggaacagcaata
tatacagaagtagttgtagatggagaaattacgaaaacagcaaaatccagtagttcttct
aatccaaaatgggatgaacagctaactgtaaatgttacgccacagactacattggaattt
caagtttggagccatcgcactttaaaagcagatgctttattaggaaaagcaacgatagat
ttgaaacaagctctgttgatacacaatagaaaattggaaagagtgaaagaacaattaaaa
ctttccttggaaaacaagaatggcatagcacaaactggtgaattgacagttgtgcttgat
ggattggtgattgagcaagaaaatataacaaactgcagctcatctccaaccatagaaata
caggaaaatggtgatgccttacatgaaaatggagagccttcagcaaggacaactgccagg
ttggctgttgaaggcacgaatggaatagataatcatgtacctacaagcactctagtccaa
aactcatgctgctcgtatgtagttaatggagacaacacaccttcatctccgtctcaggtt
gctgccagacccaaaaatacaccagctccaaaaccactcgcatctgagcctgccgatgac
actgttaatggagaatcatcctcatttgcaccaactgataatgcgtctgtcacgggtact
ccagtagtgtctgaagaaaatgccttgtctccaaattgcactagtactactgttgaagat
cctccagttcaagaaatactgacttcctcagaaaacaatgaatgtattccttctaccagt
gcagaattggaatctgaagctagaagtatattagagcctgacacctctaattctagaagt
agttctgcttttgaagcagccaaatcaagacagccagatgggtgtatggatcctgtacgg
cagcagtctgggaatgccaacacagaaaccttgccatcagggtgggaacaaagaaaagat
cctcatggtagaacctattatgtggatcataatactcgaactaccacatgggagagacca
caacctttacctccaggttgggaaagaagagttgatgatcgtagaagagtttattatgtg
gatcataacaccagaacaacaacgtggcagcggcctaccatggaatctgtccgaaatttt
gaacagtggcaatctcagcggaaccaattgcagggagctatgcaacagtttaaccaacga
tacctctattcggcttcaatgttagctgcagaaaatgacccttatggacctttgccacca
ggctgggaaaaaagagtggattcaacagacagggtttactttgtgaatcataacacaaaa
acaacccagtgggaagatccaagaactcaaggcttacagaatgaagaacccctgccagaa
ggctgggaaattagatatactcgtgaaggtgtaaggtactttgttgatcataacacaaga
acaacaacattcaaagatcctcgcaatgggaagtcatctgtaactaaaggtggtccacaa
attgcttatgaacgcggctttaggtggaagcttgctcacttccgttatttgtgccagtct
aatgcactacctagtcatgtaaagatcaatgtgtcccggcagacattgtttgaagattcc
ttccaacagattatggcattaaaaccctatgacttgaggaggcgcttatatgtaatattt
agaggagaagaaggacttgattatggtggcctagcgagagaatggtttttcttgctttca
catgaagttttgaacccaatgtattgcttatttgagtatgcgggcaagaacaactattgt
ctgcagataaatccagcatcaaccattaatccagaccatctttcatacttctgtttcatt
ggtcgttttattgccatggcactatttcatggaaagtttatcgatactggtttctcttta
ccattctacaagcgtatgttaagtaaaaaacttactattaaggatttggaatctattgat
actgaattttataactcccttatctggataagagataacaacattgaagaatgtggctta
gaaatgtacttttctgttgacatggagattttgggaaaagttacttcacatgacctgaag
ttgggaggttccaatattctggtgactgaggagaacaaagatgaatatattggtttaatg
acagaatggcgtttttctcgaggagtacaagaacagaccaaagctttccttgatggtttt
aatgaagttgttcctcttcagtggctacagtacttcgatgaaaaagaattagaggttatg
ttgtgtggcatgcaggaggttgacttggcagattggcagagaaatactgtttatcgacat
tatacaagaaacagcaagcaaatcatttggttttggcagtttgtgaaagagacagacaat
gaagtaagaatgcgactattgcagttcgtcactggaacctgccgtttacctctaggagga
tttgctgagctcatgggaagtaatgggcctcaaaagttttgcattgaaaaagttggcaaa
gacacttggttaccaagaagccatacatgttttaatcgcttggatctaccaccatataag
agttatgaacaactaaaggaaaaacttctttttgcaatagaagagacagagggatttgga
caagaatga

DBGET integrated database retrieval system